CAZyme Information: MGYG000000076_03412

Basic Information

• Species: Roseburia intestinalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia intestinalis
• CAZyme ID: MGYG000000076_03412
• CAZy Family: GH113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		36054.9	4.9348

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000076	4318260	Isolate	United Kingdom	Europe

• Gene Location: Start: 5998; End: 6933 Strand: -

Full Sequence      

MEYICGVTFAPFACAGAFFKPGAKESLAMMKERTGANFVIFVPGGLQETPQSEEICFTSK
ATMEDDELIAMIEYAKEIGLRVALKPTVNCKNGTWRAHINFFDEDVPCEPKWGNWFTSYT
AFQLHYAKIAEQYGCEMFIAGCEMVMSEHREAEWRKLLSDIRQVYHGLLSYNTDKYQEHR
VNWWDAVDVISSSGYYPYGDWENQLDRIETVVNRFQKPFFFAETGCMSVKGSKEVPNDWC
VRGDADPKGQAEWYEDMFTACSKRDWVGGMALWSWDAKLYQERSAKTRMDYEIYAKPAEK
VVKKYYDIFNK

Enzyme Prediction     

No EC number prediction in MGYG000000076_03412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH113	4	303	5.4e-110	0.9934640522875817

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd19606	GH113-like	1.52e-107	3	306	1	303	Glycoside hydrolase family 113 beta-mannosidase and similar proteins. Family 113 glycoside hydrolases cleave (1->4)-beta-glycosidic linkages, such as endo-1,4-beta-mannanase. This family also includes TIM-barrel domains found in gene transfer agent proteins.
cd19608	GH113_mannanase-like	2.20e-85	3	306	2	310	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL10421.1	2.34e-243	1	311	1	311
EEV02560.1	9.15e-241	1	311	1	311
VCV21219.1	9.15e-241	1	311	1	311
CBL12365.1	5.29e-240	1	311	1	311
BCN30091.1	3.20e-172	1	307	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YLH_A	5.42e-125	1	306	1	306	Structureof GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLH_B Structure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112]
5YLI_A	4.41e-124	1	306	1	306	Complexstructure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLI_B Complex structure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLK_A Complex structure of GH 113 family beta-1,4-mannanase with mannobiose [Amphibacillus xylanus NBRC 15112],5YLK_B Complex structure of GH 113 family beta-1,4-mannanase with mannobiose [Amphibacillus xylanus NBRC 15112],5YLL_A Structure of GH113 beta-1,4-mannanase complex with M6. [Amphibacillus xylanus NBRC 15112],5YLL_B Structure of GH113 beta-1,4-mannanase complex with M6. [Amphibacillus xylanus NBRC 15112],5Z4T_A Complex structure - AxMan113A-M3 [Amphibacillus xylanus NBRC 15112],5Z4T_B Complex structure - AxMan113A-M3 [Amphibacillus xylanus NBRC 15112]
7DV7_A	1.09e-101	1	306	35	340	ChainA, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DV7_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5]
7DVJ_A	8.80e-101	1	306	35	340	ChainA, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DVJ_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5]
7DVZ_A	1.43e-99	1	306	35	340	ChainA, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DVZ_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DW8_A Chain A, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DW8_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DWA_A Chain A, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DWA_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000008	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000076_03412.