CAZyme Information: MGYG000000078_02349

Basic Information

• Species: Lachnospira rogosae_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira rogosae_A
• CAZyme ID: MGYG000000078_02349
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000000078_9|CGC1	35669.72	5.6027

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000078	3032544	Isolate	United Kingdom	Europe

• Gene Location: Start: 19312; End: 20265 Strand: +

Full Sequence      

MITVSKDNTGDYTSIQEAVDAISSSTVSETIFIKNGTYNERVEITHNNITLIGESMDNVI
ITKDYYALMTMPDNTKRGTFRSYTFFVHANNFHAYNITFVNSSGFGTEVGQAIAVYAEGD
NITFKNCKLLGHQDTLFTGPLPLKEKQPGGFTGPTEFAPRILSRQLYEDCFISGEIDFIF
GSATAYFKNCTLYALNRNKEINSYYTAPSTYEGQKYGYVFENCNFTGNCPDGTCYLSRPW
RIHAKTVLINCKYSSQIAGSGFHDWNKPEAHETTFYAEYNGYGEGYKPNERASFAHILTA
DEAAMYTKENVLGKDFR

Enzyme Prediction     

No EC number prediction in MGYG000000078_02349.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	2	312	2e-92	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	5.37e-72	1	314	83	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	3.06e-61	2	315	2	298	Pectinesterase.
PLN02432	PLN02432	3.60e-52	1	316	12	291	putative pectinesterase
PLN02773	PLN02773	1.42e-50	1	306	6	290	pectinesterase
PLN02665	PLN02665	2.58e-45	2	306	70	348	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR72174.1	3.48e-167	1	312	1	311
ADZ82949.1	8.42e-118	4	312	3	312
QEH68466.1	2.40e-117	4	312	3	312
SET76962.1	4.72e-112	1	312	1	313
ABX41678.1	1.70e-105	2	315	5	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NSP_A	8.44e-33	4	313	8	335	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	1.24e-29	11	258	43	285	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	5.42e-29	2	314	11	289	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	1.47e-28	4	305	7	290	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1C_A	2.82e-28	2	314	11	289	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.57e-38	1	306	6	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q43062	1.36e-35	4	285	211	473	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
O49298	3.58e-35	2	316	251	541	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q9ZQA4	6.97e-35	1	307	41	322	Putative pectinesterase 14 OS=Arabidopsis thaliana OX=3702 GN=PME14 PE=2 SV=1
Q8RXK7	5.38e-34	1	312	258	554	Probable pectinesterase/pectinesterase inhibitor 41 OS=Arabidopsis thaliana OX=3702 GN=PME41 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999179	0.000707	0.000064	0.000006	0.000002	0.000066

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000078_02349.