CAZyme Information: MGYG000000078_02412

Basic Information

• Species: Lachnospira rogosae_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira rogosae_A
• CAZyme ID: MGYG000000078_02412
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
672	MGYG000000078_9|CGC2	77149.79	4.713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000078	3032544	Isolate	United Kingdom	Europe

• Gene Location: Start: 89434; End: 91452 Strand: -

Full Sequence      

MKSIYLLKEDFKNFPIGEFPYDKNHSAMGEYHFVQYPGYYGKWYDPVCNYRYNGQGASWV
ITEYCGKHYMEQMRLHNTEPHRTFPTLETGDRFWKDYDIEASVRMFNTKWGNAGIGFCAQ
NSLNMLVFMFEDKQVKLVYRHKENVEELESKAFDYNSDDTYILNVSVNGSHVECYVNGTK
YIDIDTVYAVQGGKAAITATIPAAFGYINVNVDEKTDERIKAKREEYSNKCTEAQSRYPK
MKLVKKIDLKGCGTGRQVRFGHLLGNGEYQMVLAQCQKRVNRDAYGTISCLTAMDLDGNI
LWQYGEPTDNMEIGNISADMPMQIYDIDGDGYDEVITAKNFEVLILDGKTGNVKKRAKTP
LSTMEEDGTIIGVPDGEYAFDRINPDGMRICNFRGLDKPRDILIKDRYCRVYALNDDLEV
MWHFQSDKNTGHFPFAIDINGDGYDELLVGYNMLDCNGKKMWTMPFKVDHIDEIVPGRFE
TGPNKGKKFFACVAGTQGFILCDFEGNILKQDGIGHAQRVSLANYCPDKEGYEMAVVNFW
GHQGIIYFYDSEGNDMWEMENELNGNLLTPVNWTGDGQDFILLNADVKRGGMIDGNGIQV
VKFPDDGHPTLCTEAVNLLGDARDEIVTWDYNYMYIYTQDDEPMENAYKPYKYPDYNASN
YRGEYSYRKIFW

Enzyme Prediction     

No EC number prediction in MGYG000000078_02412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	415	656	2.2e-17	0.40594059405940597

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	7.51e-08	261	638	117	527	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL43373.1	1.45e-215	4	667	6	664
ADQ05930.1	2.06e-215	2	667	4	664
ACM61423.1	2.35e-214	4	670	6	667
AGC68608.1	2.60e-214	2	669	4	665
ANW98952.1	2.60e-214	2	669	4	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z8R_A	2.59e-06	261	638	120	529	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000078_02412.