CAZyme Information: MGYG000000079_02037

Basic Information

• Species: Exiguobacterium sp902362975
• Lineage: Bacteria; Firmicutes; Bacilli; Exiguobacterales; Exiguobacteraceae; Exiguobacterium; Exiguobacterium sp902362975
• CAZyme ID: MGYG000000079_02037
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
230	MGYG000000079_28|CGC1	26095.08	4.8174

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000079	2825544	Isolate	United Kingdom	Europe

• Gene Location: Start: 19498; End: 20190 Strand: +

Full Sequence      

MKRMMLRLTGFIIVLVLLLGAVGWLGQHDKVNNGLYRTYYGENGVPNTHLAVYQDAADTY
DVDWRLLAAVHRVETIFSHSSSMRSSVGAIGPFQFMPRTWLGWEYDTDDQKGDVPEDEVD
LTDLALIEQYGGLGRDGNGDGKADPHSLVDSAHTAAYYLSEHGGKKTDSVTSVRNAIFEY
NRSEQYVNDVMTYFENYKSSVTFLPDERDTLSQRVAYYTIRYVEWFKSLG

Enzyme Prediction     

No EC number prediction in MGYG000000079_02037.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	62	200	7e-19	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	5.46e-22	60	191	1	103	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG2951	MltB	4.50e-07	44	163	107	240	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd13403	MLTF-like	0.007	54	198	2	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACQ69264.1	3.05e-169	1	230	1	230
QPI69013.1	1.24e-168	1	230	1	230
QUP88467.1	1.24e-168	1	230	1	230
QUE87803.1	3.98e-126	13	229	2	218
ASI35177.1	7.44e-74	3	201	2	200

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.768620	0.219695	0.009503	0.000486	0.000384	0.001323

TMHMM  Annotations     

start	end
5	27