CAZyme Information: MGYG000000081_00333

Basic Information

• Species: Corynebacterium propinquum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium propinquum
• CAZyme ID: MGYG000000081_00333
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		45012.49	8.0523

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000081	2502902	Isolate	United Kingdom	Europe

• Gene Location: Start: 357769; End: 358974 Strand: -

Full Sequence      

MQEKWSHRADLAETAINDRHAGPVWSVPGTNLARVSWPALFKERLFIHWHYWWQAHYLDC
QVDAALRQPTKTRSKRIANTMRGIKLRQLRGLERNKYYDDKAWLALAFGRVEKADKLGTP
PQLNALRTNLRAGLDTTLGVAPWRDSRSTFYNVPTNGPVAIMLARTGYWKEAIHIVDWVF
DNLQNDDGLIMDGMRMRMHGPEIVRDIHPYCQGVMLGASLEIALKLRAEHGIHSLEDIQS
VHEAERADEAMPYISRIRSLVHAISQHMATPAGVIDWDTGDGDGGLFKGILLRYLADVAV
RLPDDSPANRATRKLATRLVRASAESVWTHRLEVDGLPVFATDWTSDALLPHNFGLGPMS
IREKVGVVRIAERDLSVQLSGWMALEAMARVALAEGDTAAG

Enzyme Prediction     

No EC number prediction in MGYG000000081_00333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	44	356	1.6e-65	0.8016759776536313

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	3.95e-132	8	395	2	374	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	6.31e-08	50	328	33	314	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQU85989.1	4.86e-302	1	401	1	401
QQU90086.1	9.81e-302	1	401	1	401
AHI21114.1	9.51e-207	1	392	1	391
APT95908.1	1.92e-206	1	392	1	391
AQX71918.1	1.92e-206	1	392	1	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	8.46e-15	48	389	85	387	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
3K7X_A	8.70e-15	4	393	2	342	ChainA, Lin0763 protein [Listeria innocua]
6Y8F_A	1.58e-13	48	389	86	388	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	9.05e-13	48	389	86	388	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000081_00333.