CAZyme Information: MGYG000000081_02096

Basic Information

• Species: Corynebacterium propinquum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium propinquum
• CAZyme ID: MGYG000000081_02096
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522	MGYG000000081_10|CGC1	58857.72	9.4365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000081	2502902	Isolate	United Kingdom	Europe

• Gene Location: Start: 82305; End: 83873 Strand: -

Full Sequence      

MRPYTASQLTRIPLDRRDGWSLLLIGVFAALTRFIGLGHPVSGGTPIFDEKHYVPQAWDI
VRSWDHLLIGGIESNPGYGLVVHPPLAKQIIALAELIFGYSPWGWRAMAAFFGTGVVIAT
MLLARELTQSWNVGAFAGLLATFDGVLLVSSRFGMLDIFQVFFITAAAWMLARDHRHMRS
RMHSAWQSLADASPQQLWPSPFGPRFGVRWWRFGAGLLLGGALAVKWSGLYYIAFFGLFC
VFGDLIIRRRYGVARPYSAVWLRDIPAALASLVLVPVLVYLWTWRAWFASETAVYRHAAT
DGTIEDDSWLQALPDTVASWLYYHQSVLEFHATLTTSGGHDHPWDSKPWAWLAGVRPILY
YSNTELACPLGGSDNGCREMLFLFGTPAIWWFIVPGLLWALWAVLVRKERAFGWPLVGFA
AGFVPWLAAYDRQMYFFYAAAFIPFVIALYAIILGGLAHRGRYLRWRLLTRLAGRELTAG
SVVVIVYLATVVAMFVYFSPILYGLPIPDGWYHSMMWLPSWT

Enzyme Prediction     

No EC number prediction in MGYG000000081_02096.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	26	288	6.1e-63	0.9865470852017937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	4.55e-54	27	521	48	693	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	8.40e-14	320	519	3	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam02366	PMT	1.64e-10	24	177	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	4.33e-09	83	174	136	226	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
COG4745	COG4745	1.10e-04	23	181	19	161	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQU90402.1	0.0	1	522	46	567
QQU85674.1	0.0	1	522	46	567
ATZ05771.1	6.51e-257	18	522	35	530
ATZ07464.1	6.51e-257	18	522	35	530
ART22454.1	1.63e-256	18	522	41	536

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NRZ6	7.72e-216	16	521	32	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
L8F4Z2	4.98e-139	13	521	31	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	9.67e-138	13	521	37	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	9.67e-138	13	521	37	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q9UKY4	3.81e-10	20	245	58	268	Protein O-mannosyl-transferase 2 OS=Homo sapiens OX=9606 GN=POMT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	37
102	124
131	148
153	172
208	225
230	247
260	282
382	404
411	430
435	457
477	499