CAZyme Information: MGYG000000082_00157

Basic Information

• Species: Acinetobacter mesopotamicus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter mesopotamicus
• CAZyme ID: MGYG000000082_00157
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290	MGYG000000082_1|CGC1	31565.13	9.7911

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000082	3378595	Isolate	United Kingdom	Europe

• Gene Location: Start: 152108; End: 152980 Strand: -

Full Sequence      

MKINVHVLGRYGISGLLLASCCHFAYAGQTIYQLRDSNGSTLLTNKKSRYNHLQVEKKTY
YPDSNIHSYSNWGSSEASVLPSYSRNKNAYDSIIRQAAQTYGVSEGLIKAVMHTESGFNV
QARSPVGAQGLMQLMPATARRFNVSNAYDPQQNIMAGAKYLAWLLKRFNGNTTLALAGYN
AGEGNVAKYKGVPPFRETQDYVRRVSSRYQNLYAQGLGNHSAAHTASSDTGRVIASSDNY
STETTTASNIQAAKYQRQIIAQADGSFTDAPAGSYATANASASAKIYLSE

Enzyme Prediction     

No EC number prediction in MGYG000000082_00157.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	107	214	4.5e-33	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.18e-50	105	210	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.44e-45	89	210	5	147	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	4.29e-44	90	210	4	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.66e-37	94	201	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	1.25e-36	94	212	1	159	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZM11271.1	1.64e-203	1	290	1	290
QXR08299.1	4.70e-203	1	290	1	290
QJB49192.1	1.35e-202	1	290	1	290
QXX86537.1	3.86e-202	1	290	1	290
AUC07226.1	5.48e-202	1	290	1	290

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.39e-16	91	205	418	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.40e-16	91	205	422	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.41e-16	91	205	432	562	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.41e-16	91	205	428	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	1.42e-16	91	205	438	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.69e-41	91	209	61	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	4.46e-40	73	228	1408	1560	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	4.46e-40	73	228	1408	1560	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	1.21e-14	94	193	11	112	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
P39434	1.59e-14	89	222	479	634	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002121	0.399187	0.597744	0.000367	0.000307	0.000261

TMHMM  Annotations     

start	end
7	29