CAZyme Information: MGYG000000082_00160

Basic Information

• Species: Acinetobacter mesopotamicus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter mesopotamicus
• CAZyme ID: MGYG000000082_00160
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000000082_1|CGC1	41382.85	9.9469

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000082	3378595	Isolate	United Kingdom	Europe

• Gene Location: Start: 155093; End: 156208 Strand: -

Full Sequence      

MHSSSSTGSRLCLRSVISSLPLKALVLSTAFIPLHSINASKTTLQFDHVVNSNKLTVVAV
ENPTTVFQDGQHLHGFGYDLVRNYANNLNVKLDFKIVPDNNTALQWVAQGKANLAMTTTD
IRTIENKRLTSFSATCGDESILSSNGLNTNLNLVFKSATDPLSQTASAFVCKGKQSGAMK
QLASFYNQNVVKEESWTTIQRDLNNRLPIYEASFKQTAQQYNLDWHLLAAIGYQESYLKP
NSVSPTGVRGLMMLTNSTAKAMGVSNRTDPAQSIQGGAKYYDQMLSRYEHIPFPDRNWFA
LVAYNMGPGAVNQLQKRIQSQGKNPNNWVNLYAYLDQNKANNGRYRQAVQYVTRIRAYLE
HIKTTPQLVNI

Enzyme Prediction     

No EC number prediction in MGYG000000082_00160.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	221	364	4.5e-24	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	5.36e-72	214	364	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	1.40e-68	9	358	2	446	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	3.05e-55	198	362	259	431	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	9.72e-26	214	324	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.20e-22	227	360	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUC07229.1	1.86e-268	1	371	1	371
QZD33724.1	4.39e-267	1	371	1	371
QXX86540.1	1.26e-266	1	371	1	371
QZM11268.1	1.03e-265	1	371	1	371
QKU20978.1	1.03e-265	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	6.42e-45	160	367	207	428	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
5AA4_A	7.16e-45	160	368	200	422	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_B	7.16e-45	160	368	200	422	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
4OWD_A	7.36e-45	160	367	214	435	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	7.36e-45	160	367	214	435	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02RN8	5.52e-44	160	368	238	460	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=mltF PE=3 SV=2
A6V102	5.61e-44	160	368	239	461	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=mltF PE=3 SV=1
Q9HXN1	5.61e-44	160	368	239	461	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mltF PE=1 SV=2
A4VP14	1.96e-43	153	368	230	459	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=mltF PE=3 SV=2
A1U3J1	3.52e-42	160	360	234	446	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.500562	0.497186	0.001097	0.000642	0.000245	0.000252

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000082_00160.