CAZyme Information: MGYG000000082_02498

Basic Information

• Species: Acinetobacter mesopotamicus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter mesopotamicus
• CAZyme ID: MGYG000000082_02498
• CAZy Family: AA6
• CAZyme Description: NAD(P)H dehydrogenase (quinone)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
199	MGYG000000082_31|CGC1	21275.56	7.412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000082	3378595	Isolate	United Kingdom	Europe

• Gene Location: Start: 22704; End: 23303 Strand: +

Full Sequence      

MMQPYVLVLYYSKYGSTKEMAHLIANGIEAAGVAVKIRTVPNISSMVKVAEPSIPAEGDI
YCTLDDLAQCAGLALGSPTRFGNMSSEMKYFWDQTTSLWLNGALHGKPACVFTASGSMHG
GQESTLLTMLPPLFHHGMMIMGLSNATSALSNTKTGGTPYGASHVSGPRHDQGLSPDEKI
LCEVQGKRLGEVVLKLNRV

Enzyme Prediction     

No EC number prediction in MGYG000000082_02498.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA6	6	194	3.3e-66	0.9846153846153847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK03767	PRK03767	3.96e-54	6	198	4	200	NAD(P)H:quinone oxidoreductase; Provisional
TIGR01755	flav_wrbA	1.53e-46	6	196	3	197	NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR (SP:P03032) are not detected. [Energy metabolism, Electron transport]
COG0655	WrbA	5.06e-42	1	198	1	207	Multimeric flavodoxin WrbA [Energy production and conversion].
COG0426	NorV	3.64e-11	5	125	248	346	Flavorubredoxin [Energy production and conversion].
pfam03358	FMN_red	2.82e-09	67	142	67	140	NADPH-dependent FMN reductase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD7285530.1	1.51e-103	20	185	1	166
CAD7238093.1	1.99e-52	20	196	1	177
BAM82206.1	1.93e-36	2	196	1	200
ABD62982.1	6.65e-34	6	196	4	199
ANB15094.1	1.97e-33	6	197	6	202

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZWK_A	8.98e-76	4	196	13	205	Structureof WrbA from Pseudomonas aeruginosa [Pseudomonas aeruginosa],1ZWK_B Structure of WrbA from Pseudomonas aeruginosa [Pseudomonas aeruginosa],1ZWL_A Structure of WrbA from Pseudomonas aeruginosa in complex with FMN [Pseudomonas aeruginosa]
2A5L_A	3.15e-72	4	196	6	198	Thecrystal structure of the Trp repressor binding protein WrbA from Pseudomonas aeruginosa [Pseudomonas aeruginosa],2A5L_B The crystal structure of the Trp repressor binding protein WrbA from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
2ZKI_A	5.76e-39	3	192	4	190	Crystalstructure of hypothetical Trp repressor binding protein from Sul folobus tokodaii (ST0872) [Sulfurisphaera tokodaii],2ZKI_B Crystal structure of hypothetical Trp repressor binding protein from Sul folobus tokodaii (ST0872) [Sulfurisphaera tokodaii],2ZKI_C Crystal structure of hypothetical Trp repressor binding protein from Sul folobus tokodaii (ST0872) [Sulfurisphaera tokodaii],2ZKI_D Crystal structure of hypothetical Trp repressor binding protein from Sul folobus tokodaii (ST0872) [Sulfurisphaera tokodaii],2ZKI_E Crystal structure of hypothetical Trp repressor binding protein from Sul folobus tokodaii (ST0872) [Sulfurisphaera tokodaii],2ZKI_F Crystal structure of hypothetical Trp repressor binding protein from Sul folobus tokodaii (ST0872) [Sulfurisphaera tokodaii],2ZKI_G Crystal structure of hypothetical Trp repressor binding protein from Sul folobus tokodaii (ST0872) [Sulfurisphaera tokodaii],2ZKI_H Crystal structure of hypothetical Trp repressor binding protein from Sul folobus tokodaii (ST0872) [Sulfurisphaera tokodaii]
4LA4_A	1.28e-36	6	196	5	203	Crystalstructure of native PnpB [Pseudomonas sp. WBC-3],4LA4_B Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LAF_A Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_B Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_C Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_D Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3]
3ZHO_A	2.44e-34	6	197	3	196	X-raystructure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],3ZHO_B X-ray structure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],4YQE_A Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],4YQE_B Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],5F12_A WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12],5F12_B WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9I509	1.82e-75	1	196	1	196	NAD(P)H dehydrogenase (quinone) OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA0949 PE=1 SV=1
Q0A961	3.58e-48	6	196	4	197	NAD(P)H dehydrogenase (quinone) OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=Mlg_1277 PE=3 SV=1
Q39LI8	1.41e-42	6	196	4	198	NAD(P)H dehydrogenase (quinone) OS=Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) OX=482957 GN=Bcep18194_C7634 PE=3 SV=1
B9JEB9	7.74e-42	6	196	4	197	NAD(P)H dehydrogenase (quinone) OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) OX=311403 GN=Arad_2057 PE=3 SV=1
B2IEF8	7.74e-42	4	197	2	198	NAD(P)H dehydrogenase (quinone) OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712) OX=395963 GN=Bind_1932 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000082_02498.