CAZyme Information: MGYG000000082_02572

Basic Information

• Species: Acinetobacter mesopotamicus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter mesopotamicus
• CAZyme ID: MGYG000000082_02572
• CAZy Family: AA3
• CAZyme Description: Oxygen-dependent choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	MGYG000000082_34|CGC1	61474.57	6.3623

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000082	3378595	Isolate	United Kingdom	Europe

• Gene Location: Start: 5504; End: 7159 Strand: -

Full Sequence      

MNYDYIIIGAGSAGNVLAARLTEDPDVKVLLLEAGGPDYRLDFRTQMPAALAYPLQGRRY
NWAYLTDPEPHMNNRRMECGRGKGLGGSSLINGMCYIRGNAMDLEQWASLKGLEHWNYAQ
CLPYYKKAETRDIGGNDYHGDSGPVSVATPKNGNNELFHAMVEAGVQAGYPRTDDLNGYQ
QEGFGPMDRTVTPQGRRSSTARGYLDMAKGQDNLTIITHAMTNRILFNRNQAIGVEYFEG
QNTLQPIQVFADREVLLCAGAIASPQILQRSGVGPAELLKSLDIPVVQDLPGVGENLQDH
LEMYLQYKCKKPVSLYPALKWYNQPMIGAEWLFLGKGIGASNQFEAGGFIRSSDEFEWPN
IQYHFLPVAINYNGTNAIHEHGFQAHVGSMRSPSRGRVRLKSKDPFEHPSILFNYMSTEQ
DWREFRDAIRITREIMHQPVLDPYRGEEISPGKHLQTDAEIDEFVRNHAETAYHPSCSCK
MGEDDMAVVDGYGRVHEMQGLRVIDASIMPLIITGNLNATTIMIAEKLADHIRGKPALAP
SSAPFYKAPRA

Enzyme Prediction     

No EC number prediction in MGYG000000082_02572.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	2	533	1.5e-163	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2303	BetA	0.0	1	540	6	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
PRK02106	PRK02106	0.0	1	551	4	550	choline dehydrogenase; Validated
TIGR01810	betA	0.0	4	538	1	532	choline dehydrogenase. Choline dehydrogenase catalyzes the conversion of exogenously supplied choline into the intermediate glycine betaine aldehyde, as part of a two-step oxidative reaction leading to the formation of osmoprotectant betaine. This enzymatic system can be found in both gram-positive and gram-negative bacteria. As in Escherichia coli, Staphylococcus xylosus, and Sinorhizobium meliloti, this enzyme is found associated in a transciptionally co-induced gene cluster with betaine aldehyde dehydrogenase, the second catalytic enzyme in this reaction. Other gram-positive organisms have been shown to employ a different enzymatic system, utlizing a soluable choline oxidase or type III alcohol dehydrogenase instead of choline dehydrogenase. This enzyme is a member of the GMC oxidoreductase family (pfam00732 and pfam05199), sharing a common evoluntionary origin and enzymatic reaction with alcohol dehydrogenase. Outgrouping from this model, Caulobacter crescentus shares sequence homology with choline dehydrogenase, yet other genes participating in this enzymatic reaction have not currently been identified. [Cellular processes, Adaptations to atypical conditions]
pfam00732	GMC_oxred_N	6.36e-62	73	302	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
pfam05199	GMC_oxred_C	1.10e-46	394	528	3	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWP09430.1	1.52e-185	2	547	19	565
ANI26486.1	2.94e-185	2	549	70	618
CAB3230510.1	8.31e-184	3	546	25	569
CAG5089487.1	2.09e-158	3	547	17	573
CAG5086058.1	9.82e-158	1	548	13	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HA6_A	1.09e-81	2	529	1	501	Crystalstructure of pyridoxine 4-oxidase - pyridoxamine complex [Mesorhizobium loti]
3T37_A	1.74e-81	2	529	17	517	Crystalstructure of pyridoxine 4-oxidase from Mesorbium loti [Mesorhizobium loti]
3LJP_A	2.48e-78	3	533	14	527	ChainA, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
6ZH7_A	3.82e-78	3	543	8	571	ChainA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	3.82e-78	3	543	8	571	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6DKY4	0.0	1	546	1	543	Oxygen-dependent choline dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=betA PE=3 SV=1
Q1CFR7	0.0	1	546	1	545	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1
Q1C932	0.0	1	546	1	545	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=betA PE=3 SV=1
Q02DZ0	0.0	3	548	5	549	Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=betA PE=3 SV=1
Q4ZM63	0.0	3	548	7	551	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000082_02572.