CAZyme Information: MGYG000000083_01594

Basic Information

• Species: Peribacillus simplex
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-1321; Peribacillus; Peribacillus simplex
• CAZyme ID: MGYG000000083_01594
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000000083_2|CGC2	44452.22	5.0045

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000083	5860218	Isolate	United Kingdom	Europe

• Gene Location: Start: 323615; End: 324817 Strand: -

Full Sequence      

MLHGKISSMILTLVFMVSFTFLFGLKAEAADPVHTVTSGETVESIAKTYDISAEQLMKTN
GLPDDKLFAGQNLAIIQTAYTPSIYQWSERGKKIANYAKSFIGFKKTAGEETPEKGFDSS
GLIHWVLSQQNVPVDRLTVDGFYKQGMDTATPKTGDIIFFLEKDSLKVVTAGIYIGKNQF
VNSGYGAETVQVRSTTEDYFAKYQVAYKTYTPKGEHIVQTGETLNSISENYSISMSAIKS
RNALSTDELMQGQYLQLYSNPLYPFYVNQEAAYDKAYDVIKYAYTLRGFTYVFGGEDPMI
GMDCSGFIYWVMKEQGLSVKRDSAADYFSLVPKIENPKAGDLVFFSDTGTRLGVTHVGIY
LGDGRFLNTTENTGVHISNLSSGYFAEKFESFGQVESLMD

Enzyme Prediction     

No EC number prediction in MGYG000000083_01594.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	5.29e-25	291	389	4	100	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	4.89e-23	278	392	77	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
PRK13914	PRK13914	4.13e-21	34	395	202	481	invasion associated endopeptidase.
PRK10838	spr	5.08e-12	287	389	78	178	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase.
pfam01476	LysM	1.54e-10	34	75	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASS95752.1	1.46e-282	1	400	1	400
QYF84459.1	3.52e-274	1	400	1	400
AZV63102.1	3.37e-272	1	400	1	400
QOS90631.1	6.51e-270	1	400	1	400
AMM94312.1	7.89e-255	1	400	1	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XCM_A	2.58e-10	272	395	110	230	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
3PVQ_A	3.44e-10	274	379	154	264	Crystalstructure of a putative dipeptidyl-peptidase VI (BT_1314) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3PVQ_B Crystal structure of a putative dipeptidyl-peptidase VI (BT_1314) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],4R0K_A Crystal structure of a putative dipeptidyl-peptidase VI (BT_1314) from Bacteroides thetaiotaomicron VPI-5482 at 1.75 A resolution [Bacteroides thetaiotaomicron VPI-5482],4R0K_B Crystal structure of a putative dipeptidyl-peptidase VI (BT_1314) from Bacteroides thetaiotaomicron VPI-5482 at 1.75 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3NPF_A	1.46e-09	279	379	159	264	Crystalstructure of a putative dipeptidyl-peptidase VI (BACOVA_00612) from Bacteroides ovatus at 1.72 A resolution [Bacteroides ovatus ATCC 8483],3NPF_B Crystal structure of a putative dipeptidyl-peptidase VI (BACOVA_00612) from Bacteroides ovatus at 1.72 A resolution [Bacteroides ovatus ATCC 8483]
2K1G_A	5.72e-09	287	397	17	125	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96740	2.85e-21	94	398	39	289	Gamma-DL-glutamyl hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=pgdS PE=1 SV=2
O07532	3.83e-20	33	389	93	481	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
O31852	1.65e-18	36	389	31	407	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
P96645	3.41e-18	279	396	212	329	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
P54421	5.61e-17	218	389	153	328	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000319	0.998972	0.000215	0.000173	0.000154	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000083_01594.