CAZyme Information: MGYG000000083_03271

Basic Information

• Species: Peribacillus simplex
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-1321; Peribacillus; Peribacillus simplex
• CAZyme ID: MGYG000000083_03271
• CAZy Family: CBM50
• CAZyme Description: D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000000083_4|CGC5	36931.22	10.6624

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000083	5860218	Isolate	United Kingdom	Europe

• Gene Location: Start: 314540; End: 315580 Strand: +

Full Sequence      

MKKSVVAFSTLAILSSTFVSPALAGTYTVKSGDNLSKIAQKHNTTVKDLKQLNNLKSDFL
RINQKLTTPNSKTTSNASSVSVKKTKKTTYTIVSGDTLTRIANKHNLTLAELMKMNNLKS
DRIYAGAKLIVSKSTTTTTIDLPGSSKPSNVTQTPANSSTYIVVKGDSLSKISRKTNLTV
AQLKSTNSLTSDLIRVGQKLKLSKSASTAPADKNDDGKVEAPSSGNKVAKLVSEAKKLIG
TPYSWAGASPSGFDCSGFIYYTFKKAGYEVPRLSSSTYYDMGKKVTSPKSGDLIFFATGS
NKAVVSHMGIYLGGGEFIHASSSKGVTISTTSNSYFKSKIIGYRSL

Enzyme Prediction     

No EC number prediction in MGYG000000083_03271.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	5.07e-40	240	344	1	104	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK06347	PRK06347	4.71e-38	15	208	321	529	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	3.70e-35	24	202	405	591	1,4-beta-N-acetylmuramoylhydrolase.
COG0791	Spr	2.42e-31	169	344	24	197	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
PRK13914	PRK13914	2.23e-26	90	343	202	478	invasion associated endopeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASS94820.1	4.80e-231	1	346	1	346
AZV62116.1	2.33e-222	1	346	1	346
QYF83352.1	1.91e-221	1	346	1	346
QNK49468.1	1.29e-219	1	346	1	346
QOS91594.1	1.81e-214	1	346	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CFL_A	1.65e-24	231	344	17	135	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
6B8C_A	2.52e-15	229	320	29	119	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
2K1G_A	3.34e-15	229	339	7	116	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]
4XCM_A	3.28e-13	160	322	4	205	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
3H41_A	9.87e-12	193	320	161	282	CRYSTALSTRUCTURE OF A NLPC/P60 FAMILY PROTEIN (BCE_2878) FROM BACILLUS CEREUS ATCC 10987 AT 1.79 A RESOLUTION [Bacillus cereus ATCC 10987]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31852	7.39e-64	26	345	89	412	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
P54421	4.36e-58	1	342	1	330	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
O07532	4.70e-57	25	342	174	483	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
Q01837	1.06e-23	85	343	193	521	Probable endopeptidase p60 OS=Listeria ivanovii OX=1638 GN=iap PE=3 SV=1
Q01839	1.22e-22	85	343	193	521	Probable endopeptidase p60 OS=Listeria welshimeri OX=1643 GN=iap PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000210	0.999128	0.000163	0.000175	0.000165	0.000147

TMHMM  Annotations     

start	end
5	27