CAZyme Information: MGYG000000083_04106

Basic Information

• Species: Peribacillus simplex
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-1321; Peribacillus; Peribacillus simplex
• CAZyme ID: MGYG000000083_04106
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264		29776.05	10.0277

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000083	5860218	Isolate	United Kingdom	Europe

• Gene Location: Start: 164270; End: 165064 Strand: +

Full Sequence      

MSRVQKNEKENDQAGELRSRIERQKAKSSLPKRSKVHQNKKKKSKVKIKFPMIQLLALFF
ILLPIGFYSLYTYLQDRPVPVTKSDQVVLKEEDKESIPTTATADDLKEKESAKAGAEKEK
EEAEAKAKAEQEAEEKAKAQQKAKEKAKAEQEAEEKAKAEQEAEEKAKAEHEAAEKAKAQ
QIADEKAKKAAAEKKKAAENVQAAKPDKESYKVVLHTVQGEETLFRISMKYYKSQEGIAL
IREWNGLNGNEISKGQVLKIPIKK

Enzyme Prediction     

No EC number prediction in MGYG000000083_04106.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01476	LysM	9.24e-07	216	261	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	7.77e-06	216	260	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	4.77e-05	216	260	2	44	Lysin motif.
COG1388	LysM	0.002	201	261	54	111	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASS96361.1	6.45e-107	1	264	1	254
QOS89969.1	1.84e-88	1	264	1	260
QNK47878.1	2.44e-81	1	264	1	260
QYF85227.1	1.48e-80	1	264	1	251
AZV63698.1	6.46e-79	1	264	1	260

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P50731	4.56e-12	212	262	187	237	Uncharacterized protein YpbE OS=Bacillus subtilis (strain 168) OX=224308 GN=ypbE PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999833	0.000179	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
50	72