CAZyme Information: MGYG000000084_00480

Basic Information

• Species: Gemmiger formicilis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger formicilis
• CAZyme ID: MGYG000000084_00480
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643		68278.13	5.3015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000084	3006488	Isolate	United Kingdom	Europe

• Gene Location: Start: 547148; End: 549079 Strand: +

Full Sequence      

MYATVQELVDALTLEEKAGLCTGAAVPRLGLPALRVNGLHSQESAGGVCFPSACAAAASF
DPEAARRMGAALGREARSGGAQLLDVPDVNLKRGPLSGRSADTWAEDPCLTGALAAAFLQ
GVQSAGVGGCAGQLAVVNQETYRRTLNRRVDERTLQEFYLPAFETAVRDGQPRAVVCSAG
QLNGTRICEDTALLTDTLRGAWGFAGAVLAEPGAVQDPTRTLAAGVDFAPADAGRLVDAV
QSGALDESVLDRAASNIIRTLLAASTQPSPADRDCTADRSLAVELAKQSGVLLRNLGALP
LHKGQKVAYIGAFADHPRYSAGHPRAPQVTSAIDAAVLHGRKIHYIEGFPTDRDQRDEAE
FLRAVAAAEAADAAVIFAGLPECAELAAADRRHMRLPECQNNLIARVAAVQKNTVVVLHT
SGPVECPWADDVSSVLCMYLAGEGLGEATDALLWGDADPCGRLPETWPLRLEDTPCYLDF
PGDGVTADYREGVYVGYRWYDARKMPVRWPFGHGLSYTGYVYRGAALDADTLTPGGTVTA
RVTVKNSGAMRGAEVVQLYVADATGAPVPGGRVPQALRRFAKIDLQPGEEREVVFTLTPQ
DISRYSPELHAWCAAPGRYEIRIGHSSRDIRAVLALQYADAKI

Enzyme Prediction     

No EC number prediction in MGYG000000084_00480.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	24	228	7.6e-43	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.66e-66	28	631	101	758	beta-glucosidase BglX.
PLN03080	PLN03080	2.56e-50	3	599	51	744	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.26e-35	291	497	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	8.97e-23	28	259	63	315	Glycosyl hydrolase family 3 N terminal domain.
pfam14310	Fn3-like	7.65e-22	554	627	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK81647.1	6.13e-193	1	643	1	670
ABX41049.1	1.11e-192	5	631	2	654
CBL26988.1	1.09e-182	1	643	1	669
QHM47964.1	3.15e-181	5	643	7	673
CBL13846.1	3.82e-181	1	638	1	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	4.44e-141	1	630	1	660	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.00e-104	9	633	9	658	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	7.51e-72	5	631	4	706	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.00e-71	5	631	4	706	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
4I3G_A	3.94e-64	7	631	56	821	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	2.43e-140	1	630	1	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	3.90e-101	9	630	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	5.47e-101	9	636	9	670	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	1.05e-88	5	638	46	745	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P27034	9.07e-83	5	636	2	808	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000084_00480.