CAZyme Information: MGYG000000085_00683

Basic Information

• Species: Collinsella aerofaciens_F
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella aerofaciens_F
• CAZyme ID: MGYG000000085_00683
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	MGYG000000085_4|CGC1	79382.32	4.9502

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000085	2097128	Isolate	United Kingdom	Europe

• Gene Location: Start: 105943; End: 108108 Strand: +

Full Sequence      

MSESIYTLRVSMAAAGAYPTISDALAAADQLYPDAEQPVMIHVDPDEYRERVEIHRSHVT
IEGETADSVRIVGSLGAKMPSEDGSGVDGTLGTFRTYTVLVDADDVRLENLTIENDAGDG
REVGQAIALYADGDRLVVDACCIKGHQDTLFLGPLPPHEAKPGGFIGPKQYAPRRVGRQY
FRRCRIEGDVDFIFGGARAYFEGCEIRSLNRDMDVNGYVTAASTPEGEPHGFVFHGCSFT
APDGVAPDSVYLGRPWREWAQTVLIDCWLGRHIKREGWWDWNKPAAHNCVQYAGAILHGP
AGDTTGWVPWANELDVMAAAGYAREQVLAGGDGWDPEGGDGDAVETAELSANGRTVHIET
YCEDEPALRARLKREGRSAAFTGKTPADFEAWKIATRTRLYDVLVLSLMDRVPIEIRELS
RVRVAGGIVRTHAMLQVERDVWMPFYLLEPSHPKLDERGLKRCYICPHGHQGAGAASVAG
VAGVPAVDDAVRRFNYDYGLRLARMGYVTVCPDARGWGYRRDWKGQGDDENSFLRGTCLN
QARMAEPLGLTVAGLNVWDNMRLIDYLEARGDIAMDDLGCFGFSGGGYMTLYLAALDPRV
RKAFVSGYLYGVDDSLLHLNGNCSCNYTPGLWRLLDMGDIASLIAPHPLLVQSCEEDHLN
GSRGLKNVDEQLEIVRDAYKLLGRRDGLRHEVCPGEHHLGVTHLAEDIEWLDSHVAECAR
A

Enzyme Prediction     

No EC number prediction in MGYG000000085_00683.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	329	3.9e-77	0.9826388888888888
CE19	464	698	8e-26	0.5753012048192772

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.28e-61	6	314	81	388	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	2.98e-50	16	311	10	275	Pectinesterase.
PLN02708	PLN02708	1.58e-41	10	336	245	550	Probable pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	3.48e-41	8	314	7	282	pectinesterase
PLN02432	PLN02432	6.28e-41	1	334	7	291	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	0.0	1	719	1	719
ATP54718.1	0.0	1	721	1	721
QUC03567.1	0.0	8	712	7	706
QIX89293.1	1.76e-96	3	336	10	348
QRP39805.1	9.97e-96	8	336	18	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.73e-28	16	331	13	301	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.98e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
3UW0_A	2.44e-24	18	283	44	305	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1C_A	3.63e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	5.80e-23	16	331	17	305	Pectinmethylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	1.43e-33	16	337	266	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
O81320	4.83e-30	10	328	167	453	Putative pectinesterase/pectinesterase inhibitor 38 OS=Arabidopsis thaliana OX=3702 GN=PME38 PE=3 SV=1
Q8L7Q7	1.62e-29	18	324	301	593	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
O04887	5.74e-29	10	310	205	472	Pectinesterase 2 OS=Citrus sinensis OX=2711 GN=PECS-2.1 PE=2 SV=1
Q9LVQ0	8.31e-29	8	314	7	282	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999871	0.000191	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000085_00683.