CAZyme Information: MGYG000000086_00444

Basic Information

• Species: Lawsonibacter sp902363045
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Lawsonibacter; Lawsonibacter sp902363045
• CAZyme ID: MGYG000000086_00444
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
219		24638.62	10.2536

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000086	3340146	Isolate	United Kingdom	Europe

• Gene Location: Start: 161316; End: 161975 Strand: -

Full Sequence      

MYSFFIDGMELPIAPQKLTVKIKGNNKTLTLINEGDINFLRAPGLTEITFDAILPMLGQY
SFANGYRRPDSYLNKLESLMTGKEPFRFLVSRVSPSGRLLYDTNMKVSLENYTVTEDATK
GPDVTVSITLKQYISYSTKTVTVVKPKPEKKPVVQQKKKRETSSAPKVKTYTVKSGDCLW
NIAKKYYGNGAQYTKIYNANKGKIKNPNLIYPGQVLTIP

Enzyme Prediction     

No EC number prediction in MGYG000000086_00444.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	171	219	2.8e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	5.08e-25	162	219	89	146	LysM domain/BON superfamily protein; Provisional
COG1652	XkdP	7.01e-17	167	219	209	262	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
NF033163	lipo_LipL71	1.29e-15	169	219	405	460	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.
cd00118	LysM	1.64e-12	169	218	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	8.90e-10	170	218	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24900.1	1.23e-67	2	219	6	227
QBK26748.1	1.46e-66	1	218	1	218
AZK48788.1	6.27e-66	2	218	3	220
QVY60926.1	3.59e-62	1	216	1	216
QPA59921.1	1.06e-60	1	218	1	226

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FIM_A	3.76e-12	171	219	99	147	Thestructure of Kbp.K from E. coli [Escherichia coli],7PVC_A Chain A, Potassium binding protein Kbp [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54335	2.51e-28	1	219	5	218	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2
P45932	1.06e-26	1	219	5	218	Uncharacterized protein YqbP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbP PE=4 SV=1
P0ADE6	1.75e-11	171	219	99	147	Potassium binding protein Kbp OS=Escherichia coli (strain K12) OX=83333 GN=kbp PE=1 SV=2
P0ADE7	1.75e-11	171	219	99	147	Potassium binding protein Kbp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=kbp PE=3 SV=2
Q9RVY3	1.69e-06	171	219	206	252	Uncharacterized protein DR_0888 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) OX=243230 GN=DR_0888 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000086_00444.