CAZyme Information: MGYG000000088_00220

Basic Information

• Species: Streptococcus lutetiensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus lutetiensis
• CAZyme ID: MGYG000000088_00220
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	MGYG000000088_1|CGC3	27975.59	4.1833

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000088	1947463	Isolate	United Kingdom	Europe

• Gene Location: Start: 223840; End: 224598 Strand: -

Full Sequence      

MKDKQVTKFFLACSTLVTCITLGINLTFRHAAHAVIAESGQVSPTATADFITSIGETARQ
IGQERNLYASVMIAQAVLESSSGQSALSQEPYYNFFGIKGAYNGNSVVMQTWEDDGSGNT
YEIDQAFRSYNSLADSLNDYANLLSWNLYADTWKSNTSSYQDATAALTGRYATDTAYADK
LNALIEQYGLTSYDEPLVTDEVQETTEQDNQTQQNNQPTKTVNPNYVWNKHRGSYTSSDI
LAEDEAWLAYIR

Enzyme Prediction     

No EC number prediction in MGYG000000088_00220.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	55	190	1.5e-29	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK08581	PRK08581	2.61e-64	47	200	320	478	amidase domain-containing protein.
COG1705	FlgJ	9.82e-62	9	195	11	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	2.07e-53	31	194	134	303	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	1.47e-32	43	194	4	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	5.97e-27	29	194	133	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTT00359.1	1.05e-171	1	252	1	252
QQE31338.1	1.05e-171	1	252	1	252
VEB82632.1	1.05e-171	1	252	1	252
AGS05854.1	1.05e-171	1	252	1	252
SQF42677.1	1.05e-171	1	252	1	252

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.72e-42	43	194	26	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.98e-41	38	200	48	218	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	4.94e-13	49	187	5	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	6.61e-13	49	187	5	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	2.30e-10	50	185	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39046	2.58e-40	47	196	62	216	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q2G222	3.44e-40	38	200	308	478	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P37710	1.46e-37	42	196	174	335	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
A2RHZ5	1.04e-34	41	194	56	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	5.43e-34	2	194	16	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.825870	0.121135	0.049522	0.000184	0.000157	0.003146

TMHMM  Annotations     

start	end
9	28