CAZyme Information: MGYG000000088_01635

Basic Information

• Species: Streptococcus lutetiensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus lutetiensis
• CAZyme ID: MGYG000000088_01635
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
196	MGYG000000088_15|CGC1	22181.27	7.1925

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000088	1947463	Isolate	United Kingdom	Europe

• Gene Location: Start: 4274; End: 4864 Strand: +

Full Sequence      

MKSRFSFVQFLVFLAVLVLGIFSPLYAHRATPSANKTEKVSYNKSEFFADIAPTIQEVAE
AYGVRPSLVIAQAALESDYGQNLLAVKYHNLFAVFAQLGNKPVTLKYKRYFVNEWQTEIG
QFAVYKSWDDAIYDYFDLLKSGKIRNSEGAYDVMVSNKGYKKPAQALQDMGFSSDPNYAS
KLIAIIEENDLTTYDK

Enzyme Prediction     

No EC number prediction in MGYG000000088_01635.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	52	191	3.7e-29	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.48e-47	1	196	1	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	5.35e-26	39	195	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	2.27e-21	30	196	305	473	amidase domain-containing protein.
pfam01832	Glucosaminidase	4.35e-20	52	191	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK05684	flgJ	1.09e-17	30	186	138	294	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTT07702.1	3.35e-138	1	196	1	196
SQG55608.1	3.35e-138	1	196	1	196
AGS04805.1	3.35e-138	1	196	1	196
ALT82052.1	1.36e-137	1	196	1	196
VEB83731.1	3.91e-137	1	196	1	196

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	5.43e-13	47	195	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	9.72e-12	43	188	2	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.27e-11	43	188	2	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	2.39e-11	41	195	57	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	7.13e-11	53	191	10	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.62e-19	34	196	39	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	1.09e-16	15	195	33	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	1.48e-16	15	195	33	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	2.02e-16	15	195	33	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P39046	2.39e-12	43	195	61	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.444080	0.517586	0.020050	0.003973	0.002247	0.012052

TMHMM  Annotations     

start	end
5	27