CAZyme Information: MGYG000000089_00946

Basic Information

• Species: CAG-353 sp900066885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-353; CAG-353 sp900066885
• CAZyme ID: MGYG000000089_00946
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	MGYG000000089_1|CGC10	39638.85	4.7537

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000089	3052732	Isolate	United Kingdom	Europe

• Gene Location: Start: 931948; End: 932985 Strand: +

Full Sequence      

MKIRKLAALILAAQMCLIAVGCADNTSVQAENTVSVTELSTKHKTSEHKLSNPDADEITQ
QVYDYICDNYGKVMLSCQQESTWMGSPDYEMDYIKETTGKLPAMRGLDFMNADFDGVVER
AEDWWEKGGLVTICWHTGINGLGYQESLNDEPDFDKLLKKGTKENKAMLENWDKAAEALV
KLRDAGVPVLWRPFHEFDGKWFWWGKGGGENFIKLWQMMYDRYTNKFGLTNLIWVLGYSG
DVRSGWYVGDDYCDIIGSDTYDNSTNKKAWKKLEKINTAEKPMSFHECGNVPSVKNFEKD
GCIWSWFMIWHTDYIKNNDEKNLKEVYNSDLVITLDELPKFTADK

Enzyme Prediction     

No EC number prediction in MGYG000000089_00946.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	51	337	2.7e-87	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.31e-42	52	337	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	4.14e-14	185	261	178	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN30282.1	1.65e-107	49	341	5	299
ADU20874.1	2.67e-107	50	339	167	460
AWB26443.1	2.67e-84	50	342	48	340
AJP70762.1	7.50e-72	40	338	12	318
AAK19890.1	1.22e-69	53	339	209	499

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WDQ_A	3.19e-52	53	339	37	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	5.94e-50	52	345	25	333	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	2.11e-48	49	329	44	330	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
3ZM8_A	1.04e-46	50	338	145	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	1.07e-43	82	338	31	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	5.49e-51	50	338	174	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	5.86e-48	49	343	145	462	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55297	6.25e-41	50	344	158	467	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	8.43e-41	50	344	156	465	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
Q5AWB7	3.45e-40	49	338	27	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000030	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000089_00946.