CAZyme Information: MGYG000000089_02773

Basic Information

• Species: CAG-353 sp900066885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-353; CAG-353 sp900066885
• CAZyme ID: MGYG000000089_02773
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		41563.92	4.6144

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000089	3052732	Isolate	United Kingdom	Europe

• Gene Location: Start: 36083; End: 37174 Strand: -

Full Sequence      

MEKKLHSFICTEDNVRIGGRTMLENDIRYMDYTCTYVEFTFTGTYAEAEIISDLTPSEDI
FRAWAVVCVNGSAQPAKRFKLDSKRAAYELYSSDKEETVTIRLMKVSEAAFSKMGVAEIR
IDGELLPPPKPQYQRRIEFVGDSITCGYGIDGVWNKDVFSTETENPIKGYAYKTAQLCKS
EFQYVSWSGMGVLSSWVDEKAEKPLDNWLITDIYPYTDSGLENTLGREGHENHTKWDFSK
YVPQVIVFNMGTNDQSWTKKIPERVEQFGEKYYAFIKMLREHNPNAYIVCAYGVMDAPLA
ETEEAQIERFKSELDDNIEFVRLPVQQEADGIGADWHPSENTHTKMAILLSEKINGIFEK
MGL

Enzyme Prediction     

No EC number prediction in MGYG000000089_02773.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	136	354	6.4e-59	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	1.57e-39	136	354	1	168	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam17996	CE2_N	1.88e-23	17	129	1	108	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
cd00229	SGNH_hydrolase	1.51e-06	137	353	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam13472	Lipase_GDSL_2	1.40e-05	139	319	1	134	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01833	XynB_like	0.001	224	347	11	150	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL50870.1	1.15e-104	2	359	10	363
ACZ98663.1	1.97e-103	14	357	9	348
ADZ84814.1	2.71e-94	11	357	6	346
QEH70287.1	2.71e-94	11	357	6	346
AIQ56995.1	2.64e-68	8	362	2	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	2.25e-35	37	354	34	327	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	6.06e-35	37	354	34	327	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAA_A	1.35e-24	6	359	11	338	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]
3U37_A	1.20e-22	11	362	45	405	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
4DEV_A	2.62e-21	11	362	45	405	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	7.08e-33	37	354	515	808	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PIB0	8.61e-24	6	359	30	357	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1
B3PDE5	3.79e-14	15	363	30	359	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000006	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000089_02773.