CAZyme Information: MGYG000000091_02501

Basic Information

• Species: Achromobacter xylosoxidans
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Achromobacter; Achromobacter xylosoxidans
• CAZyme ID: MGYG000000091_02501
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244	MGYG000000091_3|CGC2	28120.18	10.2388

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000091	6684283	Isolate	United Kingdom	Europe

• Gene Location: Start: 215306; End: 216040 Strand: +

Full Sequence      

MAARGKSGKRRSWFRIITGTLMALVCAVLLYQFWLFGLVVWYNYQNPGSSAIMREELARL
RDGNPDFQLKYEWVPYDKINRNLKRAVVASEDSNFTEHDGVEWDAIRKAWEYNQKQEAAG
RSKMRGGSTITQQLAKNLFLSSSRSYLRKGQELVLTYMIEHVMTKERILELYLNVAEWGT
GVFGAQAAARHYFNVPAANLGASQSARLAAMLPNPRFYDSHRNSNYLNSRVYTLTRRMQM
VDIP

Enzyme Prediction     

No EC number prediction in MGYG000000091_02501.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	70	239	1.5e-59	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.39e-122	10	244	1	229	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.64e-95	21	244	4	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	6.56e-72	1	238	8	240	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	7.59e-68	62	239	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.16e-50	72	243	3	168	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQG70210.1	1.29e-177	1	244	1	244
QQE56035.1	1.29e-177	1	244	1	244
QEQ21460.1	1.29e-177	1	244	1	244
QKI76294.1	1.29e-177	1	244	1	244
CCH05533.1	1.29e-177	1	244	1	244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.96e-25	73	219	22	164	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	3.86e-25	73	219	22	164	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5FGZ_A	2.31e-20	73	242	158	330	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	2.33e-20	73	242	179	351	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3UDF_A	4.22e-20	74	240	42	205	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WF82	1.87e-134	7	244	5	242	Biosynthetic peptidoglycan transglycosylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) OX=257310 GN=mtgA PE=3 SV=1
Q7W3V2	1.87e-134	7	244	5	242	Biosynthetic peptidoglycan transglycosylase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) OX=257311 GN=mtgA PE=3 SV=1
Q7W039	1.87e-134	7	244	5	242	Biosynthetic peptidoglycan transglycosylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) OX=257313 GN=mtgA PE=3 SV=2
Q2KUU2	2.04e-126	7	244	3	240	Biosynthetic peptidoglycan transglycosylase OS=Bordetella avium (strain 197N) OX=360910 GN=mtgA PE=3 SV=1
A6T2A4	1.56e-88	25	244	16	231	Biosynthetic peptidoglycan transglycosylase OS=Janthinobacterium sp. (strain Marseille) OX=375286 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999627	0.000029	0.000001	0.000000	0.000000	0.000364

TMHMM  Annotations     

start	end
13	35