CAZyme Information: MGYG000000091_03222

Basic Information

• Species: Achromobacter xylosoxidans
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Achromobacter; Achromobacter xylosoxidans
• CAZyme ID: MGYG000000091_03222
• CAZy Family: CBM50
• CAZyme Description: 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
701	MGYG000000091_4|CGC1	74413.31	6.0146

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000091	6684283	Isolate	United Kingdom	Europe

• Gene Location: Start: 227558; End: 229663 Strand: +

Full Sequence      

MKQPLRKIFALSASALLLASLSACGGSDDDDDDAPPASVPRGATLDLAILATTDLHANVL
GYDYYKLAEDKSYGVDRTATLIRNARKQHANTLLFDNGDTIQGTALSDYQALVAPVQCSD
MLAIYKQMKLLAYDAATLGNHEFNYGLPYLSQVTNVDFGLPGIGKGTAQTNPTGAKDCAA
PGFPFVSANVVAAATQQPIFKPWTLLTRTFKATGPDGKALDVALKVGVIGFAPPPIMQWD
KANLEGHVTVAGWKETAARYVPEMKAAGADLVVALAHGGIDLVTPYSPSMENGAGYLSQV
AGIDALITGHQHLLFPDTNPKSQFAGQPGIDLEKGLINGVPAVQAGQWGNNLGQITLKLA
YDQGWKVQKNATQVQRIPTRLTAQNGGTPATYVAPDSAAQQLVQAEHSATIAYVKTPIGQ
SQFDMATYYALAGDVSALQIVNMAQIDYLKDYIARNSPAYAGLPILSAAAPFKGGRNGPG
DFTFVPQGNIAINNAADLYLYPNTLQVVRVSGDIVRQWLEKTAEQFKRIDPAQVAPQDLI
DTGFPTFNFDVLYAEGNALRYQIDVTQPKGSRITALTYQGAPLDPAAQFLVVTNNYRASG
GGDFPGLAGGKGDIVLQAPDASRDVLISYIKKHPNLDLATYGLARSWGFKPVAALAGPVV
FASVPNTLALATAHGVTNVSVYDPTPDATTQLSRYAVDLTR

Enzyme Prediction     

No EC number prediction in MGYG000000091_03222.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09420	cpdB	0.0	42	701	21	649	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
TIGR01390	CycNucDiestase	0.0	45	653	1	578	2',3'-cyclic-nucleotide 2'-phosphodiesterase. 2',3'-cyclic-nucleotide 2'-phosphodiesterase is a bifunctional enzyme localized to the periplasm of Gram-negative bacteria. 2',3'-cyclic-nucleotide 2'-phosphodiesters are intermediates formed during the hydrolysis of RNA by the ribonuclease I, which is also found to the periplasm, and other enzymes of the RNAse T2 family. Bacteria are unable to transport 2',3'-cyclic-nucleotides into the cytoplasm. 2',3'-cyclic-nucleotide 2'-phosphodiesterase contains 2 active sites which catalyze the reactions that convert the 2',3'-cyclic-nucleotide into a 3'-nucleotide, which is then converted into nucleic acid and phosphate. Both final products can be transported into the cytoplasm. Thus, it has been suggested that 2',3'-cyclic-nucleotide 2'-phosphodiesterase has a 'scavenging' function. Experimental evidence indicates that 2',3'-cyclic-nucleotide 2'-phosphodiesterase enables Yersinia enterocolitica O:8 to grow on 2'3'-cAMP as a sole source of carbon and energy (). [Purines, pyrimidines, nucleosides, and nucleotides, Other]
PRK09418	PRK09418	2.37e-168	43	701	36	654	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
PRK11907	PRK11907	2.25e-162	42	651	111	681	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
PRK09419	PRK09419	7.46e-161	43	637	38	597	multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase/5'-nucleotidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYQ74930.1	1.22e-149	8	699	9	662
QOS76560.1	1.06e-146	36	674	27	643
APO43595.1	1.33e-146	36	674	25	641
QZN77538.1	1.41e-146	36	674	27	643
QLG37215.1	2.42e-146	36	674	27	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EQV_A	8.22e-78	43	367	6	297	1.45Angstrom Crystal Structure of Bifunctional 2',3'-cyclic Nucleotide 2'-phosphodiesterase/3'-Nucleotidase Periplasmic Precursor Protein from Yersinia pestis with Phosphate bound to the Active site [Yersinia pestis CO92]
3JYF_A	8.42e-77	41	414	3	337	ChainA, 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase bifunctional periplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578],3JYF_B Chain B, 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase bifunctional periplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3GVE_A	1.95e-64	47	415	12	340	Crystalstructure of calcineurin-like phosphoesterase YfkN from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3GVE_B Crystal structure of calcineurin-like phosphoesterase YfkN from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
4Q7F_A	3.98e-24	46	604	19	485	ChainA, 5' nucleotidase family protein [Staphylococcus aureus subsp. aureus COL]
3QFK_A	3.98e-24	46	604	19	485	ChainA, Uncharacterized protein [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P08331	5.93e-145	37	653	14	599	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Escherichia coli (strain K12) OX=83333 GN=cpdB PE=1 SV=2
P26265	1.00e-139	37	630	14	575	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=cpdB PE=3 SV=2
P53052	2.57e-138	38	633	20	587	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Yersinia enterocolitica OX=630 GN=cpdB PE=3 SV=1
P44764	5.41e-132	45	652	32	608	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=cpdB PE=3 SV=1
O34313	1.77e-122	35	652	31	612	Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) OX=224308 GN=yfkN PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000071	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000091_03222.