CAZyme Information: MGYG000000091_04003

Basic Information

• Species: Achromobacter xylosoxidans
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Achromobacter; Achromobacter xylosoxidans
• CAZyme ID: MGYG000000091_04003
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424		45506.77	9.7955

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000091	6684283	Isolate	United Kingdom	Europe

• Gene Location: Start: 333660; End: 334934 Strand: -

Full Sequence      

MKILLYGINYAPELTGIGKYSAELAEWLAARGHDVSVVTAPPYYPQWRVHDGYRAGRYRK
ETRAGVTVRRAPLWVPARPGGAKRLLHLASFALSSLPSLLRAAAGRPDLILVVEPALFCA
PAAWLAARLCGARAWLHIQDYEVDAAFDLGLLKGAWLRAAVRRAERWLMRRFDRVSTISG
RMLDLALYKGVEPDKAVLLPNWIDVHAIAPDRAGDLRAELGIPADAVVALYSGNMGGKQG
LETLAQVARLLEGDERLWFVFCGQGPARAPLQAQCQGLARVRFLDLQPAERLAALLNTAD
IHLLPQRAGAADLVMPSKLTGMLASGRPVVCGAARGTELAGVVAHCGLVTPPEDAVAMAE
AVRKLAGNAQVRETLGAAARRHALDHLHVDAVLAAAEREFAAVIGPRAAPAPQAADAARR
DAGR

Enzyme Prediction     

No EC number prediction in MGYG000000091_04003.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10307	PRK10307	0.0	1	405	1	410	colanic acid biosynthesis glycosyltransferase WcaI.
cd03794	GT4_WbuB-like	1.81e-101	2	381	1	375	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03801	GT4_PimA-like	8.83e-37	2	400	1	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.10e-29	1	405	1	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03798	GT4_WlbH-like	5.14e-29	15	381	14	354	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEQ24571.1	2.36e-307	1	424	1	424
AXA78955.1	9.62e-307	1	424	1	424
CCH10044.1	9.62e-307	1	424	1	424
QKQ53115.1	3.91e-306	1	424	1	424
CKH91313.1	3.91e-306	1	424	1	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KIH_A	6.91e-10	198	376	218	397	Sucrose-phosphatesynthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P32057	3.00e-97	1	339	1	345	Putative colanic acid biosynthesis glycosyl transferase WcaI OS=Escherichia coli (strain K12) OX=83333 GN=wcaI PE=4 SV=1
Q8FSH1	3.59e-10	182	383	176	386	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) OX=196164 GN=mshA PE=3 SV=1
Q6NJL3	8.52e-10	1	383	4	389	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) OX=257309 GN=mshA PE=3 SV=1
Q8KIU8	7.72e-09	131	365	119	358	Probable glycosyltransferase WbjE OS=Pseudomonas aeruginosa OX=287 GN=wbjE PE=3 SV=2
C7Q4Y6	3.37e-08	124	383	116	391	D-inositol 3-phosphate glycosyltransferase 1 OS=Catenulispora acidiphila (strain DSM 44928 / JCM 14897 / NBRC 102108 / NRRL B-24433 / ID139908) OX=479433 GN=mshA1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000091_04003.