CAZyme Information: MGYG000000091_04137

Basic Information

• Species: Achromobacter xylosoxidans
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Achromobacter; Achromobacter xylosoxidans
• CAZyme ID: MGYG000000091_04137
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705	MGYG000000091_5|CGC4	74961.15	6.8775

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000091	6684283	Isolate	United Kingdom	Europe

• Gene Location: Start: 490738; End: 492855 Strand: -

Full Sequence      

MSATLSALAMAAGLAEHWTDARQQPRAVAPDTLRALLRAMDLPADSEADIRDSHARLAAA
RSQARLPAMMVAVAGGRLRLPPACAGAYEISAAHARALAGHTTPDAAGMPELLLPTVPGY
YTLALPGGVTTLAVAPASAPPPSLLLDEPEPRAWGLAAQVYSLRRQAADPVQATHGFGDF
GALRDLAISAGAAGADALAMSPVHAMFAADPGQYSPYSPSSRLFLNTLYADPAAVLGAEA
VRAALARMGPAAQQALHALEQRDLIDWPQAARARQRLLRELHRGFQQTATADQRQALQAF
CRAGGQDLRDHALFEALHENLAQLPGAPRSWTAWPDGLRDPRSNETRGFAQAQAGELDFH
QFTQWLAAVSLSQAQQAARGAGMRIGLIADLAIGASPAGSHAWSHQADLMRRAGVGAPPD
IHNPLGQAWGLTALSPQALRESGYAAFIALLRAGLAQAGGLRIDHILGMARLWLIPDGAA
AADGAYLRYPLRTLLRLTALEAWRHRALMIGENLGTVPEGFDDALREHGLLGMDVLWFMR
EASAARSPAAFTAPGAWPAQAAAMTTTHDLPTLEGWWRGRDIDWRADLDLLSPQESAADL
RAARAADRESLWQAVRAHAHQPPEPAPEQVPAATLLAYVAAAPCPLALVPLEDATGMVDQ
PNLPGADSRHPNWRQRQPLAAADCLEAPAARERLAPLRSLRGRKP

Enzyme Prediction     

No EC number prediction in MGYG000000091_04137.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	172	699	1.7e-139	0.9736842105263158

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14507	PRK14507	1.12e-144	1	703	4	723	malto-oligosyltrehalose synthase.
PRK11052	malQ	1.25e-121	5	676	6	664	4-alpha-glucanotransferase; Provisional
COG1640	MalQ	1.30e-115	148	704	8	517	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
pfam02446	Glyco_hydro_77	3.96e-111	159	679	2	459	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PRK14510	PRK14510	2.04e-103	26	704	637	1221	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCH09923.1	0.0	1	705	1	705
QEQ24462.1	0.0	1	705	1	705
QKI68894.1	0.0	1	705	1	705
QQE59594.1	0.0	1	705	1	705
AUZ18553.1	0.0	1	705	1	705

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3P_A	5.69e-89	2	676	3	662	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	9.29e-82	2	676	3	662	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
5B68_A	1.23e-46	132	673	159	673	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
2X1I_A	1.87e-22	278	578	108	404	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
1CWY_A	4.44e-22	278	578	108	404	CrystalStructure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans [Thermus aquaticus],1ESW_A X-Ray Structure Of Acarbose Bound To Amylomaltase From Thermus Aquaticus. Implications For The Synthesis Of Large Cyclic Glucans [Thermus aquaticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15977	2.98e-88	2	676	3	662	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P65337	1.67e-72	1	683	4	691	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK22	1.67e-72	1	683	4	691	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P9WK23	1.67e-72	1	683	4	691	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1
P45176	4.17e-59	77	680	73	678	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999711	0.000305	0.000005	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000091_04137.