CAZyme Information: MGYG000000091_04143

Basic Information

• Species: Achromobacter xylosoxidans
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Achromobacter; Achromobacter xylosoxidans
• CAZyme ID: MGYG000000091_04143
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523	MGYG000000091_5|CGC4	55738.1	8.0394

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000091	6684283	Isolate	United Kingdom	Europe

• Gene Location: Start: 505564; End: 507135 Strand: -

Full Sequence      

MATTRILIVAAEAFPLAKTGGLGDAITGMARALAQAHMQPTLLLPAYRGVAQRLRPARPV
ADLAGLPGGDARLLAGVCPQSGLSFLLLENDALYDRAGLYLDDNGQEYADNALRYAALAH
AAVRIAQGLPGLPRPELVHAHDWHAALTPLLLRAAGVTDVKSVLTIHNLAFQGPAALEDA
PLLGVPAPFLGEDGAQAWGRLNFMKAGIRYADRVTTVSHRYAREILTPEFGCGLDGVLRE
RAADLCAIANGIDTQLWNPARDPHLGPLRYHPDDLANKRLCKAAAQREYGLREDPQATLL
IMCSRLTGQKMADVAALALPRALEAHPALQVAVLGQGERHLEAALRDLSQRYPGRCAVRI
GYEEAGAHRLQAAGDILLHGSRFEPFGLTPLYAMRYGTLPIGSRVGGMADTIKDPGPQQP
LTAMAGATGVLFDGSAPEDMAAAISRALHLHQHATLWRAMQRNAMTADFSWRPAVAEYLA
LFRSLTGDASAPLAGGAQPLPEIAAPRLRRVRQASTLGAPAPL

Enzyme Prediction     

No EC number prediction in MGYG000000091_04143.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	483	9.3e-149	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	5	485	2	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	5	487	2	465	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	5	484	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	4.35e-164	5	485	2	478	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	8.94e-137	1	491	1	485	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKI68889.1	0.0	1	523	1	523
AXA78843.1	0.0	1	523	1	523
CKH87452.1	0.0	1	523	1	523
SQG76339.1	0.0	1	523	1	523
QKQ52997.1	0.0	1	523	1	523

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	1.11e-97	5	485	2	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	3.94e-97	5	485	2	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
1RZU_A	1.55e-96	5	485	2	475	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
3COP_A	3.08e-96	5	485	2	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
1RZV_A	4.12e-93	5	485	2	475	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZV_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9IMI9	3.16e-213	1	522	1	518	Glycogen synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) OX=340100 GN=glgA PE=3 SV=1
Q7WIJ0	2.51e-207	1	495	1	496	Glycogen synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) OX=257310 GN=glgA PE=3 SV=1
Q7W6L5	4.11e-206	1	495	1	496	Glycogen synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) OX=257311 GN=glgA PE=3 SV=1
Q8XT73	3.89e-153	5	490	4	484	Glycogen synthase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=glgA PE=3 SV=1
Q2T6R2	3.54e-138	7	486	1	481	Glycogen synthase OS=Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) OX=271848 GN=glgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000091_04143.