CAZyme Information: MGYG000000092_00158

Basic Information

• Species: UBA7160 sp902363135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA7160; UBA7160 sp902363135
• CAZyme ID: MGYG000000092_00158
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	MGYG000000092_1|CGC4	32072.51	4.688

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000092	3773903	Isolate	United Kingdom	Europe

• Gene Location: Start: 181817; End: 182635 Strand: +

Full Sequence      

MAHFTCNFISYVLNRAVDVDVIIPGVTSTEAGEPGVTHKPRWKYPVLYLLHGYCNDYSTW
ERYTSIERYAEERRIAVVTFSAENNMYMKLQDVKKENPIEGLMEPDYEKFLMEELPDFVT
SMFPISEKPSDTYIAGLSMGGFGALSNGFRYPDRFRAVGAFSPLTTQLRKNYRENPEVPA
YLEKYEPLLLIQKAMKRGEMPDLYYCYGTEDFLYDMQDWFKEKLEENEVKCTIEVLPDYG
HEWAFWDREVKAFLDWIPRTDPYYKEAPIRRI

Enzyme Prediction     

No EC number prediction in MGYG000000092_00158.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	12	257	7.5e-46	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	1.25e-32	15	259	24	310	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	1.91e-21	43	246	23	235	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	3.44e-12	38	163	92	210	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	3.20e-07	40	165	43	178	S-formylglutathione hydrolase
COG2819	YbbA	1.22e-06	43	180	38	185	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX64683.1	6.23e-15	43	246	180	384
QUR47977.1	6.23e-15	43	246	180	384
AYZ12827.1	9.35e-15	39	253	68	270
ADG66555.1	3.13e-14	43	260	78	283
QDU23692.1	4.35e-14	15	270	55	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	1.16e-42	1	262	2	266	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7L0A_A	1.03e-24	1	257	9	258	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	4.80e-24	2	257	4	252	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
4ROT_A	1.19e-21	1	266	8	264	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
2UZ0_A	1.03e-18	7	258	11	253	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	1.68e-23	1	260	1	264	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
Q8X5J5	3.07e-10	43	245	42	258	S-formylglutathione hydrolase FrmB OS=Escherichia coli O157:H7 OX=83334 GN=frmB PE=3 SV=1
B1J086	7.65e-10	43	245	42	258	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks) OX=481805 GN=frmB PE=3 SV=1
P51025	7.65e-10	43	245	42	258	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain K12) OX=83333 GN=frmB PE=1 SV=2
B1XEU8	7.65e-10	43	245	42	258	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain K12 / DH10B) OX=316385 GN=frmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000092_00158.