CAZyme Information: MGYG000000092_00462

Basic Information

• Species: UBA7160 sp902363135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA7160; UBA7160 sp902363135
• CAZyme ID: MGYG000000092_00462
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578	MGYG000000092_1|CGC9	66734.91	4.7365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000092	3773903	Isolate	United Kingdom	Europe

• Gene Location: Start: 518543; End: 520279 Strand: +

Full Sequence      

MKLNLQEMPFSTRGSYMVVGYHEGIFNGQEIKKGIYLRTVHGMAQMPFIAQLIPVNGDEE
LSYTVEAQPHALEVKCGCGVITFSFADADTLVITGKGEMFGIRFEMLHQGSFEMIEPVMT
GRGLSYLVNSFGTKTRYMLTCQGGKENLDQKWNVSGAMHAAFQVDAVDRTFTVVLEEIED
SWYQKNTDYDIDQVCEDAKKEFDMFYQSMPVVPERFEEARRKAAYVNWSSIVKKKGFLKR
DTMFMSKNWMCNVWTWDHCFNAMALAYENPQEAWNQFMLPFDNQTETGRLPDSINDSLII
DNYCKPPIHGWTLRHLKRIMHLDKDQEYEAYQGLSKWTEWWLNYRDQDHDGLCEYTHGND
SGWDNSTVFHELPPVTSPDLATFLIIQMEELANLADAIGRTEEMEHWNHRAEKMKQQLFS
QLFDGEKPIAIRTITREKIDSESLLVYMPILLGMELPEDKKQYMIRQLKSKRFCTEHGLA
TESPQSPLYESDGYWRGPIWAPSTMLLADGLWECGEKEFVKSLTEKFCEMVLKSGCAENF
DALTGDGLRDRAYTWTASVMLVMAHEFLAEETEGTKLI

Enzyme Prediction     

No EC number prediction in MGYG000000092_00462.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	227	568	1e-48	0.41228070175438597

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	4.11e-19	214	578	245	618	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PRK10137	PRK10137	2.11e-08	227	568	320	784	alpha-glucosidase; Provisional
pfam01204	Trehalase	2.19e-04	358	534	288	462	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE95804.1	2.98e-231	1	568	1	567
CBL12731.1	4.94e-225	1	568	1	567
QBE97352.1	6.37e-220	1	570	2	575
QHQ63144.1	8.76e-204	1	568	1	569
AEE95252.1	2.87e-175	1	568	1	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WVA_A	6.38e-10	254	561	32	416	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
3W7S_A	1.47e-07	253	571	320	760	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	5.83e-07	253	571	320	760	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	7.68e-07	253	571	320	760	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D8QTR2	2.12e-12	254	561	98	482	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	2.12e-12	254	561	98	482	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P42592	8.15e-07	253	571	343	783	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000092_00462.