CAZyme Information: MGYG000000092_02588

Basic Information

• Species: UBA7160 sp902363135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA7160; UBA7160 sp902363135
• CAZyme ID: MGYG000000092_02588
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836	MGYG000000092_10|CGC1	96912.61	4.5779

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000092	3773903	Isolate	United Kingdom	Europe

• Gene Location: Start: 49171; End: 51681 Strand: +

Full Sequence      

MERQSLNGRWQMRRVGDPVFSEAIVPGSVYTDLLRNGQMEDPFFKDNELKALRLMDEDYE
YVTSFDCAKSVYRSDRKVLRFDGIDTIADVYLNGEMIGSPDNMHRTWEYDVTEEVQEKGN
ELRIVFHSPNKYIAEAFQVSKTHGSEDAMDGFVNIRKAHCMFGWDWGAHLPDAGLFRPVT
LLGVDEARIDSVYVTQEHTNGKVTLHFAVDVDCCPEMEDPSGMWNAETEEVSENEADPQE
SGLYYTVKVTAPDGTQVHATGSPEQLVIENPQLWWPNGYGRQDLYTVEVTLCFEGKELDC
WKRRIGLRTMTVDRSKNEWGENFAICVNGVDIFAMGADYIPEDHLLGRVTPETTRALLEK
SKWANFNAIRVWGGGYYPEDWFYDLCDELGFVVWQDFMFACAVYDLTPEFEANIRAEFID
NIKRLRHHASLGLWCGNNEMEEFVYAKNSWLTKPQEVRDYYLMYERIIPEIVKEYDPQTF
YWPSSPSSGGCLDEPQDPERGDVHYWDVWHGNKPFTEYRKFYFRFLSEFGFQSFPSIKTI
ETFTDDPDDMNIFSYVMERHQRNGSANGKIMNYMQQTYRYPSDFRTVLYASQLLQADGIR
YGVEHFRRNRGRCMGAVYWQLNDCWPVASWSSIDYCGRLKALHYYAKRFFAPLMLSCEER
GMMSNAQPLNWQHSGEFEKSIRLNVANETREDAKVIVHWALRKASAEVLQSGEETVAVPA
LTSVWLEKIEFPKADPYSEYISYELEKDGEIISAGSVNFSYPKYFRYEDPQLTCRVIGDE
IEVTASAYAKSVEILNENEDLILSDNYFDMNAGTKRVKIEHGDAGKLRLRSVYDIR

Enzyme Prediction     

No EC number prediction in MGYG000000092_02588.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	756	2.5e-108	0.7353723404255319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.79e-107	1	656	10	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	8.89e-17	4	439	42	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	2.12e-12	2	478	11	442	beta-D-glucuronidase; Provisional
pfam17786	Mannosidase_ig	6.75e-12	681	764	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	5.10e-11	187	308	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE97789.1	0.0	1	836	15	837
QJU13790.1	0.0	1	836	1	823
QQQ93614.1	0.0	1	836	1	823
ASU28856.1	0.0	1	836	1	823
ANU76049.1	0.0	1	836	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	8.86e-142	5	836	7	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	9.09e-142	5	836	7	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	6.45e-141	5	836	5	846	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	6.62e-141	5	836	7	848	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	2.90e-138	6	816	11	812	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4WAH4	1.39e-108	24	820	31	829	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A1CGA8	1.94e-108	24	830	31	839	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
B0YBU9	5.27e-108	24	820	31	829	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1D911	1.43e-107	24	820	31	829	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
B8NW36	2.73e-107	24	813	31	820	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000092_02588.