CAZyme Information: MGYG000000093_00345

Basic Information

• Species: Klebsiella_A grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A grimontii
• CAZyme ID: MGYG000000093_00345
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
183		20343.33	9.6775

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000093	6212272	Isolate	United Kingdom	Europe

• Gene Location: Start: 337762; End: 338313 Strand: +

Full Sequence      

MKKRIIACSTAAIISLAATLWPQALRTSPEAQLKMAKYEDCRKTPYYCPAGVLTVGIGST
SKVENREYAEGEIAERWFNDLLRAEKCVNREFNGAAAPQKVFESMTDGTFNVGCTGLGWY
TNAKGQKVRTTLWRHAQAGNWKGVCERLTDFVNSGGKRLQGLVNRREEFKAWCLSDPALK
GAK

Enzyme Prediction     

No EC number prediction in MGYG000000093_00345.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	31	168	1.4e-30	0.9562043795620438

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16901	lyz_P1	4.70e-60	26	174	1	140	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd00737	lyz_endolysin_autolysin	2.02e-25	35	167	5	129	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	1.60e-23	38	176	18	150	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16900	endolysin_R21-like	7.03e-18	44	174	21	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	1.12e-13	52	167	1	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APW89010.1	6.35e-132	1	183	1	183
BCU61213.1	6.35e-132	1	183	1	183
AUW12072.1	1.50e-130	1	183	1	183
AYZ54938.1	4.30e-130	1	183	1	183
QLO24579.1	1.75e-129	1	183	1	183

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XJU_A	5.66e-35	26	175	1	152	ChainA, Lysozyme [Punavirus P1],1XJU_B Chain B, Lysozyme [Punavirus P1]
1XJT_A	3.91e-33	25	175	28	180	ChainA, Lysozyme [Punavirus P1]
6ET6_A	9.29e-10	20	171	45	191	ChainA, Lysozyme [Acinetobacter baumannii]
3HDF_A	6.75e-06	45	174	16	136	ChainA, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]
3HDE_A	9.40e-06	45	174	41	161	ChainA, Lysozyme [Enterobacteria phage P21],3HDE_B Chain B, Lysozyme [Enterobacteria phage P21],3HDE_C Chain C, Lysozyme [Enterobacteria phage P21],3HDE_D Chain D, Lysozyme [Enterobacteria phage P21]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q37875	4.06e-34	25	175	28	180	SAR-endolysin OS=Escherichia phage P1 OX=2886926 GN=17 PE=1 SV=1
P51728	1.49e-31	26	176	34	186	SAR-endolysin OS=Haemophilus phage HP1 (strain HP1c1) OX=1289570 GN=lys PE=3 SV=1
O80292	3.28e-08	39	174	37	163	SAR-endolysin OS=Bacteriophage PS119 OX=83128 GN=19 PE=3 SV=1
O80288	2.18e-06	39	174	37	163	SAR-endolysin OS=Bacteriophage PS34 OX=83127 GN=19 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.008574	0.987495	0.003092	0.000334	0.000253	0.000250

TMHMM  Annotations     

start	end
5	25