CAZyme Information: MGYG000000093_00626

Basic Information

• Species: Klebsiella_A grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A grimontii
• CAZyme ID: MGYG000000093_00626
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
896		100067.25	5.0786

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000093	6212272	Isolate	United Kingdom	Europe

• Gene Location: Start: 607939; End: 610629 Strand: +

Full Sequence      

MPVVPTVTGRQVESRGVSNPGFQTVDQPNIGNAILGAGEQALNVFGKAKQQANVAMAQNA
SLKLSQTEEDLRTQLYGFQGQNALGKGHEFTQKYDEQIQSLSDSLPDDASRQMFMQQARL
QQVQFQGSVNRYEIGQVDAFENDQISATRKLQIKNESDSWDDPQAAAVAKNIRTVAIARY
GAARGWSQEQMLAEIEKDNQEATELRAKNYAVANPMGWLSGDFSADDNGVLDLRAVGIVE
SGGKHRNADGSLVTSPKGAQGEFQLMPETGKELAAKRGQEYNPDDPEQHAQLAKDYAGQL
SKKYQSEILAGAAYNWGMGNVDKLISKAGDPRKGEVTFENFVKQLPSETQGWLSRYRKNK
TGMDPLSVYQIDNLANSQIEKQRTLVLKELEPAYNNTMAQLNNGEVPDSIPSIPSIMFGF
GERGKKMVTQLDIAMDNAKTFQAIQYLPPNEQKAELERIKPQVNDPDYALKFDAYGKLNA
LVSRSNETIQSLKDSNRFNEALAIGEKLDPSNKSMQKAADNTPSALNFRINDATTHDGIV
QQVNQTGIIPTQVTSQLNAISRSSSPEVVKQGANLFNTLYATDPASVGDMPKDMQSFYLT
VKQLTDAGMASDEAVKQAQNVTYNQSDALKTQLSSIQNTKEYKKERSSAIDSARDSMAQW
FRIDPEADDTTTDAVNFRNDYQSLYDINYRNSGGNADVAKKMTNVQIARTWSISDVNGGT
QFMKYAPEALYNYGPSGWQAAQWKEEKEHLMYGERSEELLTNPTNLGITSGSAPVITSNT
PESRIGGDLEIIPDVLTAHNGDYAIMVRMKDKDGIESIQPHYDKFGRPMRWKPSLEDWKP
YQDMQKESEIRDQQKIIRGQEIRNFKDKHRAIDEQYRKFHSDRVNRFKNYFSWDAE

Enzyme Prediction     

No EC number prediction in MGYG000000093_00626.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	6.98e-16	233	333	4	97	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PHA00658	PHA00658	2.77e-14	15	355	33	423	putative lysin
cd16894	MltD-like	2.20e-12	232	356	9	124	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd13401	Slt70-like	9.68e-12	253	330	38	120	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.89e-11	239	335	28	123	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPQ12494.1	0.0	1	896	1	897
QIV27710.1	0.0	1	896	1	897
CAD5353680.1	0.0	1	896	1	896
ATX96370.1	0.0	1	896	1	896
QYD25718.1	0.0	1	896	1	897

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000093_00626.