CAZyme Information: MGYG000000093_01267

Basic Information

• Species: Klebsiella_A grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A grimontii
• CAZyme ID: MGYG000000093_01267
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	MGYG000000093_2|CGC2	62002.53	9.5297

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000093	6212272	Isolate	United Kingdom	Europe

• Gene Location: Start: 162239; End: 163894 Strand: -

Full Sequence      

MKSIRYGASLVALFVLYYILPLNFRLLWQPDETRYAEISREMLATGDWVVPHFLGLRYFE
KPIAGYWINSIGQWLFGHNNFAVRFGVVFSITVTALLVAWLAWRLFRDKRVAILSPVIFL
TALLVYGIGTYAVLDPMITMWMALAMCSCWGATQAQSHSGKIFGYVLLGVACGMGVMTKG
FLALAVPVVGVLPWVIARKRWREVLTYGWLAVGVCALVVLPWGLAIAKREPDFWRYFFWV
EHIQRFAEKDAQHKAPFWYYIPFLIAGSLPWLALLPGALKRGWTERDEARGALYLLGWVA
MPLLFFSIAKGKLPTYILPCFAPLSILMARYALDAAKAGAKALKINGAINLAFGLIGLVA
VLVVSPWGFMHKPVWSHIELYKCLLAALIFGWWALMGWLAMKDNGRRWTLAACCPLGLAL
LVGFAIPDRVIDSKQPQFLVDIVSESLTPSRYVLTNNVGIAGGLSWELKRSDIILFDKQG
ELKYGLSWPDAQHQFVDQAHFADWLATHRQQGPVSLVLLMDKGESMADLALPKPDSFYEL
GRVVFIQYLPQ

Enzyme Prediction     

No EC number prediction in MGYG000000093_01267.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	5	518	1.1e-149	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	0.0	1	550	2	552	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	1.37e-94	10	524	13	535	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	2.54e-39	3	237	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	6.47e-10	61	222	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXW39882.1	0.0	1	551	1	551
QLT62573.1	0.0	1	551	1	551
BAS43253.1	0.0	1	551	1	551
QHI85645.1	0.0	1	551	1	551
VTS26606.1	0.0	1	551	1	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	6.47e-30	11	426	38	452	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6TF96	0.0	1	551	1	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=arnT PE=3 SV=1
B5XTL1	0.0	1	551	1	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=arnT PE=3 SV=1
B7LM74	4.60e-254	1	551	1	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=arnT PE=3 SV=2
B7N5M2	1.51e-247	1	551	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=arnT PE=3 SV=1
B1LLL1	2.14e-247	1	551	1	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli (strain SMS-3-5 / SECEC) OX=439855 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000006	0.000001	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
7	29
81	103
112	134
175	197
204	226
257	279
292	309
314	333
346	368
378	400
407	426