CAZyme Information: MGYG000000093_01319

Basic Information

• Species: Klebsiella_A grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A grimontii
• CAZyme ID: MGYG000000093_01319
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
142		15975.22	7.2653

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000093	6212272	Isolate	United Kingdom	Europe

• Gene Location: Start: 217464; End: 217892 Strand: +

Full Sequence      

MSPTIPPLSLQGLEFIKRAQGLALVPYRDESGLRVIGYGHVLNDYETFSHFTREVAETLL
TVDLLQCQRELKRSLQVTLNQVQYDALVSLAFSCGAASPALNIVLTHLNHQRFAEALNAW
GNIRSGREQRREECARFKACTD

Enzyme Prediction     

No EC number prediction in MGYG000000093_01319.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	9	123	3.3e-24	0.8540145985401459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	4.10e-27	12	137	1	135	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	1.28e-18	8	133	7	142	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16901	lyz_P1	4.54e-13	8	133	2	134	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd00735	T4-like_lys	6.68e-08	14	133	4	137	bacteriophage T4-like lysozymes. Bacteriophage T4-like lysozymes hydrolyze the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1), as well as Dictyostelium.
pfam00959	Phage_lysozyme	1.59e-07	35	128	3	98	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI85598.1	1.69e-98	1	142	1	142
QXW39838.1	1.69e-98	1	142	1	142
QLT86069.1	6.87e-98	1	142	1	142
QTP46497.1	6.87e-98	1	142	1	142
QTP40400.1	6.87e-98	1	142	1	142

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4EVX_A	1.22e-12	13	118	12	103	Crystalstructure of putative phage endolysin from S. enterica [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4EVX_B Crystal structure of putative phage endolysin from S. enterica [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
2ANV_A	2.22e-11	8	120	4	120	ChainA, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
6ET6_A	8.24e-06	1	132	45	187	ChainA, Lysozyme [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9T1T5	2.24e-11	8	109	3	103	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1
P09963	6.19e-11	8	120	4	120	Endolysin OS=Salmonella phage P22 OX=10754 GN=19 PE=1 SV=1
Q37896	1.40e-09	8	133	3	137	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
P07540	6.15e-08	8	116	3	113	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
P11187	6.15e-08	8	116	3	113	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000093_01319.