CAZyme Information: MGYG000000093_01580

Basic Information

• Species: Klebsiella_A grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A grimontii
• CAZyme ID: MGYG000000093_01580
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
180	MGYG000000093_2|CGC10	20284.89	5.5903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000093	6212272	Isolate	United Kingdom	Europe

• Gene Location: Start: 501592; End: 502134 Strand: +

Full Sequence      

MNKDEIFNAILEKEGGYVNHADDSGGPTNWGITQVTARAHGYDGDMQKLTRQQALDILNA
DYWIAPRFDHVAEISTAIAEKLCDAGVNMGPVLPGKWLQRWLNAFNHRGAFYPDLMIDGV
IGPRTLNALSHYLIRRGNEGELVLLRALNCSQGQYYLELAERNDANESFIYGWLRTRVSM

Enzyme Prediction     

No EC number prediction in MGYG000000093_01580.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	7	90	5.6e-28	0.9767441860465116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3926	ZliS	4.00e-53	2	178	4	172	Lysozyme family protein [General function prediction only].
cd13926	N-acetylmuramidase_GH108	7.15e-36	1	90	1	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
pfam05838	Glyco_hydro_108	1.13e-33	7	90	1	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
pfam09374	PG_binding_3	6.72e-25	94	178	2	76	Predicted Peptidoglycan domain. This family contains a potential peptidoglycan binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWT20562.1	6.39e-135	1	180	1	180
QLT88517.1	6.39e-135	1	180	1	180
QQQ23814.1	6.39e-135	1	180	1	180
BAS40444.1	5.25e-134	1	180	1	180
QXW37360.1	3.55e-132	1	180	1	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6V40_A	1.65e-85	3	180	20	197	ChainA, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_B Chain B, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_C Chain C, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_D Chain D, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi]
6V3Z_A	1.44e-84	3	178	22	197	ChainA, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis],6V3Z_B Chain B, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis]
2IS5_A	4.21e-22	5	175	8	153	Crystalstructure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_B Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_C Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_D Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B]
2IKB_A	4.31e-22	5	175	7	152	CrystalStructure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_B Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_C Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_D Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58]
7DNP_A	1.92e-09	10	129	13	122	ChainA, Secretion activator protein, hypothetical [Brucella abortus bv. 1 str. 9-941]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000093_01580.