CAZyme Information: MGYG000000093_01714

Basic Information

• Species: Klebsiella_A grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A grimontii
• CAZyme ID: MGYG000000093_01714
• CAZy Family: CE8
• CAZyme Description: Pectinesterase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418	MGYG000000093_2|CGC11	45989.48	8.7687

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000093	6212272	Isolate	United Kingdom	Europe

• Gene Location: Start: 641489; End: 642745 Strand: +

Full Sequence      

MRKITILGISALLCTPLLLQGCVSQNPRGTASRPQLTAAEAATFTMERYFAKGGALSAPD
GPWSPSPARLPRVESAWRVAPSGAPFTRIQQAVNAAINQHAAGDERIYIRIEPGIYRETV
YIPEGAPPITLYGAGDNPQAVRIELAIDSQFPVSRYRQQVNSQQQYREGDPAWYQYALCA
GRTARTIGTNCAAVMWSQSADFQLLNLSVVNSLLDTVDGATHQGVALRTDGDRVQLENVR
LLGRQDTLYVNTSNRRNEAVTDRISRVYVKDSYVEGDVDYVFGRANVVFDNVHFHTVSTR
RSPEAYVLAPNTLPDNPCGFLVINSRFTGDSGYRGGFKAKLGRAWDQGASKTGYLPGKTA
NGQALIANSTIDQSYDRLSPWGAAATTSRPFRGNPAAERQLDDVAFNRLWEFNNHWQP

Enzyme Prediction     

EC	3.1.1.11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	81	374	1.4e-56	0.7847222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10531	PRK10531	0.0	7	414	15	416	putative acyl-CoA thioester hydrolase.
COG4677	PemB	2.34e-107	17	414	17	398	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	3.00e-25	81	345	77	289	pectinesterase family protein
PLN02773	PLN02773	2.31e-20	78	345	8	224	pectinesterase
pfam01095	Pectinesterase	1.59e-18	79	345	4	220	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTP43923.1	1.32e-310	1	418	1	418
BAS40583.1	1.32e-310	1	418	1	418
QLO78464.1	3.11e-309	1	418	1	418
QLT64972.1	1.26e-308	1	418	1	418
QHI87924.1	1.26e-308	1	418	1	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GRH_A	2.85e-94	25	414	29	409	Crystalstructure of escherichia coli ybhc [Escherichia coli K-12]
4PMH_A	8.27e-85	25	414	2	361	Thestructure of rice weevil pectin methyl esterase [Sitophilus oryzae]
3UW0_A	2.62e-14	223	379	155	307	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.45e-07	223	379	129	283	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1GQ8_A	7.38e-07	86	347	19	229	Pectinmethylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q47474	7.69e-175	8	413	8	426	Pectinesterase B OS=Dickeya dadantii (strain 3937) OX=198628 GN=pemB PE=1 SV=2
P55743	4.60e-151	29	414	8	396	Pectinesterase B OS=Pectobacterium parmentieri OX=1905730 GN=pemB PE=3 SV=2
P46130	1.81e-93	25	414	34	414	Putative acyl-CoA thioester hydrolase YbhC OS=Escherichia coli (strain K12) OX=83333 GN=ybhC PE=1 SV=2
E7CIP7	2.91e-83	25	414	18	377	Pectinesterase OS=Sitophilus oryzae OX=7048 GN=CE8-1 PE=1 SV=1
P58601	1.24e-49	30	414	30	389	Pectinesterase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=pme PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000032	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000093_01714.