CAZyme Information: MGYG000000093_02841

Basic Information

• Species: Klebsiella_A grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A grimontii
• CAZyme ID: MGYG000000093_02841
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MGYG000000093_4|CGC7	80984.69	5.7264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000093	6212272	Isolate	United Kingdom	Europe

• Gene Location: Start: 472233; End: 474428 Strand: +

Full Sequence      

MIKPVTKLMLVALLSALGSAGAMAAERSHFEHFITRDGATLKDGDKVFRFAGIHAPELHR
IEDDARGTCKADTRGWGQYFRWPTAEEQENWIKAMVQTGARAQRVYVLSVQQTFDEACGR
ETHILAPETTDGMPRLNEKAMRVYDNMIAEADKQGLRLILPFIDHWWWWGGREQLAAFYH
EKPEDFYRTDSKTFKAYLDVIRQVITRTNSVTGRPYFDEKAIMAWETGNELEDTNAAFLQ
QTAAWIKKWAPHQLVVDGTYKKINGFALNDPNVDIVSNHYYTNADNNHPDQVKKDLTAAA
GKKVYMVGEFGLLDAQQLNAIMQSIVHSEVNGAQAAGGLIWGFRGHRHDGGFYWHKESTG
HYSYHLPGFPMEGKANEEMEVVDLVRTAAAQMNGQENAPPLPKPDAPTLRATDSPFAINW
LGAAVGRAYDVERADSASGPWKVVGRDISDGVNEWNPQTMDLFRDDYRSLQLGNTYYYRV
IAKNESGSSAPSNVISVKHTQANQAPVVALAETLTTSQDQGVQLSASWRDDGLPDRDVKV
NWSNGGSAQAHFCTTDKAETRAWFSAPGEYALTFSADDGLLKSSKTVKVTVTEAAGKVPA
DYCRFGGGVLHVTEGKIEAAKSEKDALTIDEDGFLGPFANDGDKVSWQVSAPWAGKYLLR
VTFSGKWGGKKNSFIVNGGAPIAVEFPQTDEQGQQQLVPVELKAGDNRIDFGKFAGDWGY
MFIKSIEVVAE

Enzyme Prediction     

No EC number prediction in MGYG000000093_02841.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	88	351	1.2e-126	0.99609375
CBM35	614	728	4.8e-20	0.957983193277311

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16990	CBM_35	7.44e-43	609	730	1	119	Carbohydrate binding module (family 35). This is a mannan-specific carbohydrate binding domain, previously known as the X4 module. Unlike other carbohydrate binding modules, binding to substrate causes a conformational change.
cd04086	CBM35_mannanase-like	5.50e-15	632	728	25	118	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
cd04083	CBM35_Lmo2446-like	1.65e-10	633	728	27	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04081	CBM35_galactosidase-like	1.20e-06	649	719	45	117	Carbohydrate Binding Module family 35 (CBM35); appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. This family includes carbohydrate binding module family 35 (CBM35); these are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. Examples of proteins which contain CBM35s belonging to this family includes the CBM35 of an exo-beta-1,3-galactanase from Phanerochaete chrysosporium 9 (Pc1,3Gal43A) which is appended to a GH43 domain, and the CBM35 domain of two bifunctional proteins with beta-L-arabinopyranosidase/alpha-D-galactopyranosidase activities from Fusarium oxysporum 12S, Foap1 and Foap2 (Fo/AP1 and Fo/AP2), that are appended to GH27 domains. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). Some CBM35s bind their ligands in a calcium-dependent manner. In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates, while family GH27 includes alpha-galactosidases, alpha-N-acetylgalactosaminidases, and isomaltodextranases.
cd04082	CBM35_pectate_lyase-like	1.05e-04	617	709	3	106	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARI10099.1	0.0	1	731	1	731
QLO81069.1	0.0	3	731	2	730
QLT67423.1	0.0	3	731	2	730
VTS41294.1	0.0	1	731	1	731
BAS42409.1	0.0	1	731	1	731

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UUQ_A	1.60e-08	85	275	65	269	Exo-mannosidasefrom Cellvibrio mixtus [Cellvibrio mixtus],1UZ4_A Common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis [Cellvibrio mixtus],7ODJ_AAA Chain AAA, Man5A [Cellvibrio mixtus]
3PZ9_A	2.35e-08	145	266	103	234	Nativestructure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	3.73e-08	145	266	89	220	X-raystructure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]
4LYP_A	3.23e-06	192	279	200	291	CrystalStructure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei],4LYP_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei]
4LYR_A	3.23e-06	192	279	200	291	GlycosideHydrolase Family 5 Mannosidase from Rhizomucor miehei, E301A mutant [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FZ03	1.51e-08	137	285	113	281	Mannan endo-1,4-beta-mannosidase 2 OS=Solanum lycopersicum OX=4081 GN=MAN2 PE=2 SV=2
Q6YM50	1.51e-08	137	285	113	281	Mannan endo-1,4-beta-mannosidase 5 OS=Solanum lycopersicum OX=4081 GN=MAN5 PE=2 SV=1
Q9FUQ6	4.46e-08	137	285	102	270	Mannan endo-1,4-beta-mannosidase 3 OS=Solanum lycopersicum OX=4081 GN=MAN3 PE=3 SV=1
O48540	5.82e-08	137	346	101	359	Mannan endo-1,4-beta-mannosidase 1 OS=Solanum lycopersicum OX=4081 GN=MAN1 PE=1 SV=2
Q6Z310	5.68e-07	137	341	113	366	Putative mannan endo-1,4-beta-mannosidase 9 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN9 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000314	0.998917	0.000180	0.000208	0.000179	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000093_02841.