CAZyme Information: MGYG000000093_04918

Basic Information

• Species: Klebsiella_A grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A grimontii
• CAZyme ID: MGYG000000093_04918
• CAZy Family: GH91
• CAZyme Description: Inulin fructotransferase [DFA-I-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	MGYG000000093_12|CGC2	49185.08	4.7652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000093	6212272	Isolate	United Kingdom	Europe

• Gene Location: Start: 61383; End: 62747 Strand: +

Full Sequence      

MVPENYYDVTRWPVGNPYQDIGEVINSIIADIKSRQTETDINDAGKPGAAIFIPPGDYHL
TTQVLIDISYLKIMGAGHGFVSSSIRFNTPADEWANLHDLWPGGSRILVDLCPQDGDEEH
AGAAFYVKRSGAPRISSVAFENFCIDGLHFVDDGLGNNDPENTYTNGKTGIYIASAQDAF
RITGMGFIYLEHGLTAYNSDAMAIHNNFIAECGNCIELRGAGQASKITDNLIGAGYKGYS
IYAQNFGGLLISTNNIFPRGASSVHLSGVVRSCVTSNRFHSFYPGMLIMENNCAENLISA
NHFLRDREPWPPMQAYDNGRDDTYGLLYIEGSNNSIIANHISETLDVQYLKPRGIKPIVI
RLVAGKGNYLANNHIVATTEASAAQAQPSEEDACFAAQVSALLTTDRLKALDAVAVLVEK
SSAQNTILDSGSDSQVLMDRAVNAFRATPVPGTI

Enzyme Prediction     

EC	4.2.2.18	4.2.2.17	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH91	4	449	9.2e-195	0.9949367088607595

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd21111	IFTase	0.0	4	449	2	395	inulin fructotransferase. Inulin fructotransferase (IFTase; EC 4.2.2.17 and EC 4.2.2.18), a member of the glycoside hydrolase family 91, catalyzes depolymerization of beta-2,1-fructans inulin by successively removing the terminal difructosaccharide units as cyclic anhydrides via intramolecular fructosyl transfer. As a result, IFTase produces DFA-I (alpha-D-fructofuranose-beta-D-fructofuranose 2',1:2,1'-dianhydride) and DFA-III (alpha-D-fructofuranose-beta-D-fructofuranose 2',1:2,3'-dianhydride).
pfam05048	NosD	7.81e-04	162	324	35	188	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam13229	Beta_helix	0.007	214	343	1	112	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTP46155.1	0.0	1	454	1	454
QXW39486.1	0.0	1	454	1	454
BAS38076.1	0.0	1	454	1	454
QQQ21567.1	0.0	1	454	1	454
QLT90842.1	0.0	1	454	1	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZKS_A	1.08e-213	1	452	1	444	Crystalstructure of DFA-IIIase from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZKU_A Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_B Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_C Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_D Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_E Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_F Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKW_A Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_B Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_C Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_D Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_E Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_F Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6]
5ZL5_A	2.53e-212	1	452	1	444	Crystalstructure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_B Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_C Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_D Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_E Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_F Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZLA_A Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_B Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_C Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_D Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_E Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_F Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6]
5ZKY_A	2.35e-204	1	452	1	419	Crystalstructure of DFA-IIIase from Arthrobacter chlorophenolicus A6 without its lid [Pseudarthrobacter chlorophenolicus A6],5ZL4_A Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 wihout its lid in complex with GF2 [Pseudarthrobacter chlorophenolicus A6]
2INU_A	7.34e-113	5	376	13	369	Crystalstructure of Inulin fructotransferase in the absence of substrate [Bacillus sp. snu-7],2INU_B Crystal structure of Inulin fructotransferase in the absence of substrate [Bacillus sp. snu-7],2INU_C Crystal structure of Inulin fructotransferase in the absence of substrate [Bacillus sp. snu-7],2INV_A Crystal structure of Inulin fructotransferase in the presence of di-fructose [Bacillus sp. snu-7],2INV_B Crystal structure of Inulin fructotransferase in the presence of di-fructose [Bacillus sp. snu-7],2INV_C Crystal structure of Inulin fructotransferase in the presence of di-fructose [Bacillus sp. snu-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19870	6.44e-92	7	381	6	358	Inulin fructotransferase [DFA-I-forming] OS=Arthrobacter globiformis OX=1665 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000093_04918.