CAZyme Information: MGYG000000093_05716

Basic Information

• Species: Klebsiella_A grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A grimontii
• CAZyme ID: MGYG000000093_05716
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767		86063.47	5.6721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000093	6212272	Isolate	United Kingdom	Europe

• Gene Location: Start: 30414; End: 32717 Strand: -

Full Sequence      

MGPVYQPGDTEESGLTFFTLYMNLAPYAAYKQQGSLADRKVAGVQRYYSSAEDLQAGRTA
GKLEKDTVVTLSDTIVTRSSDQRQFTEVTITRETKNVAGNTLAAGAKVWTVSDQGNLKAT
ESVPVPSWWAKCTPAYTNQSEGLVNCTSRTNWAYYLSSNDVLQYKNAGSLVADFPLSYEP
GNTAQQVIRPGKNPGDAARTFSLVTLGRDKDKLKKGDRVWVVSDGDSLTPVAPAASGSEP
VFNDVYVPSAPVPVNAGDSLGHMGFYQLPEENGKRSRYQVHIECLSMDDMEKFITNPGKA
GEDAPVYLTWKADAPLFDKSDTGITAGGRKTKGPGILTLAKVPGVDAEGNTLSSNQDAAY
YQIRPEGGWLAAASVQKVSQYALGELGFVTLNKASESFDLIDGIKQPDNVVKGILEQLYK
AAEEETRTTHALNKYNYKRLLELIDSNQDGHYSEQEYLQAVHNVSYRDHLYRVIAKHASE
WYYGKDDPLWNTYLDTLTTDAPLWKTYLEAFLDKMTWMKAVSEKDVALGPDPWHMHPVVF
LAAMKAVNKQCYCYKQGIADRPCQSGAVDVTKDDFELLATQLGVEREVLRAIAVAETGDK
VPFRYYVRDERHAAILYERHYMKRISLNLGVSTETVREVESSEPDIIHSYDSSYRHGRDS
EQYQRLLRAREINFDAANMSCSWGKFQVMGEYYHHLYSSTQELVDAQNYCAMQHLQYFKI
FLVNEKRMLQSMKDKDWLTIARKYNGTGQIGYDEIIENAYNSLKNEW

Enzyme Prediction     

No EC number prediction in MGYG000000093_05716.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam11860	Muraidase	7.33e-31	587	760	3	170	N-acetylmuramidase. Endolysins are bacteriophage encoded proteins synthesized at the end of the lytic infection cycle. They degrade the peptidoglycan (PG) of the host bacterium to allow viral progeny release. This domain family is found in bacteria and viruses. It is also found associated with pfam01471. One of the family members is the modular Gp110 endolysin found in the Salmonella phage. This domain represents the catalytic region found in the C-terminal of Gp110. It has been demonstrated to have N-acetylmuramidase (lysozyme) activity cleaving the beta-(1,4) glycosidic bond between N-acetylmuramic acid and N-acetylglucosamine residues in the sugar backbone of the PG. Furthermore, sequence alignments containing this domain show that the Gp110 E101 residue is conserved (suggesting that is is the catalytic residue), and followed by serine (a common feature in lysozymes). The structure of endolysins varies depending on their origin. In general, most of the endolysins from phages infecting Gram-positive bacteria have a modular structure consisting of one or two N-terminal enzymatic active domains (EADs) and a C-terminal cell wall binding domain (CBD) separated by a short linker. In silico analysis indicate that this endolysin has a modular structure harboring this EAD family at the C-terminus and a PG_binding_1 CBD at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QET67342.1	0.0	6	541	127	662
AKM86944.1	0.0	6	552	127	673
QHP31272.1	0.0	6	549	127	670
QFU48309.1	0.0	6	549	127	670
QDW12774.1	0.0	6	549	127	670

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7Q4S_AAA	5.54e-14	570	764	23	206	ChainAAA, Endolysin [Pseudomonas phage JG004],7Q4S_BBB Chain BBB, Endolysin [Pseudomonas phage JG004],7Q4T_AAA Chain AAA, Endolysin [Pseudomonas phage JG004]
5NM7_A	1.15e-13	570	760	75	258	Crystalstructure of Burkholderia AP3 phage endolysin [Burkholderia],5NM7_G Crystal structure of Burkholderia AP3 phage endolysin [Burkholderia]
7RUM_A	1.10e-06	570	763	96	284	ChainA, Endolysin [Salmonella phage GEC_vB_GOT],7RUM_B Chain B, Endolysin [Salmonella phage GEC_vB_GOT]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000015	0.000049	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000093_05716.