CAZyme Information: MGYG000000095_00958

Basic Information

• Species: GCA-900066755 sp902363085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp902363085
• CAZyme ID: MGYG000000095_00958
• CAZy Family: GH93
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668	MGYG000000095_2|CGC2	74420.55	4.377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000095	5524222	Isolate	United Kingdom	Europe

• Gene Location: Start: 271117; End: 273123 Strand: +

Full Sequence      

MRRFFVFLLTFTMMISGLTMTASAEDAEGNTVFGDEQTPHSFYERMVQLPNGDLLATWLR
EFPVNTGWTGMQDPQFYKSADQGKTWHMCSEINPAANGISKDKIGMPGLYVFPQALGNYP
AGTILCAVSDWDTDSTYTIHIWRSTDNAESWQLHSELAPRAGRSTWEPEFAVSADGRLVC
YYSDERQEGYDQCISYEVSDDGGLTWGDYTIVAGEYEEGWIPGVSPGNWRPGMPRVIQLK
DGSYLMAHENINAEPYGSITIRRSADGLSWGDPLALGSVVTTGQYTAYQCPMIALIDDGS
EYGRLFLRGMNDNCSPSQCFTSTDNGRTWSLIDAPLTAVRNENVGSSWSGTFVADGDKLI
ELNNYYNGSYNEIRCGTGVLCGDQLVVSGADYKFVNAANGYCMDDPAGSVEQGTQMILWS
DNSLKTQSWHLEDMANGQYKIRCNYSGLILDNKEGSTADGSIVRQWEDNNAPAQRWLLES
QPDGTFHIQNQAGGLYLDTQNQAADLHTPLVQSPLNGSATQRWKLERIYEIARLESFNIA
GRYIRHTSDGRIIIDTEFTSLPLKDSEWRIVPGLADAGCISFESVNMPGYYLRHRDGRLQ
LSQNDQTALMAEDATWRVRPGLADSSQVSFESYNIAGNYMRHMDGVLHITGISSDLDRAD
ATFREIRQ

Enzyme Prediction     

No EC number prediction in MGYG000000095_00958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	40	313	3.2e-70	0.8599348534201955
CBM42	533	664	2.7e-43	0.9779411764705882
CBM13	391	528	3.5e-27	0.6914893617021277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05270	AbfB	5.41e-51	533	664	2	136	Alpha-L-arabinofuranosidase B (ABFB) domain. This family consists of several fungal alpha-L-arabinofuranosidase B proteins. L-Arabinose is a constituent of plant-cell-wall poly-saccharides. It is found in a polymeric form in L-arabinan, in which the backbone is formed by 1,5-a- linked l-arabinose residues that can be branched via 1,2-a- and 1,3-a-linked l-arabinofuranose side chains. AbfB hydrolyzes 1,5-a, 1,3-a and 1,2-a linkages in both oligosaccharides and polysaccharides, which contain terminal non-reducing l-arabinofuranoses in side chains.
pfam05270	AbfB	1.82e-21	534	618	53	137	Alpha-L-arabinofuranosidase B (ABFB) domain. This family consists of several fungal alpha-L-arabinofuranosidase B proteins. L-Arabinose is a constituent of plant-cell-wall poly-saccharides. It is found in a polymeric form in L-arabinan, in which the backbone is formed by 1,5-a- linked l-arabinose residues that can be branched via 1,2-a- and 1,3-a-linked l-arabinofuranose side chains. AbfB hydrolyzes 1,5-a, 1,3-a and 1,2-a linkages in both oligosaccharides and polysaccharides, which contain terminal non-reducing l-arabinofuranoses in side chains.
pfam14200	RicinB_lectin_2	2.67e-20	427	512	3	88	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	5.56e-17	387	466	10	89	Ricin-type beta-trefoil lectin domain-like.
pfam00652	Ricin_B_lectin	8.83e-14	392	523	3	126	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD84758.1	3.54e-135	8	437	10	439
QTH40928.1	5.68e-130	2	429	6	431
SDS04433.1	1.16e-129	12	432	16	434
ACX67045.1	1.16e-129	1	432	5	434
QOT10786.1	3.58e-128	15	432	19	434

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A71_A	1.02e-24	35	249	17	223	Highresolution structure of Penicillium chrysogenum alpha-L-arabinanase [Penicillium chrysogenum],3A72_A High resolution structure of Penicillium chrysogenum alpha-L-arabinanase complexed with arabinobiose [Penicillium chrysogenum]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000238	0.999075	0.000173	0.000196	0.000149	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000095_00958.