CAZyme Information: MGYG000000095_01743

Basic Information

• Species: GCA-900066755 sp902363085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp902363085
• CAZyme ID: MGYG000000095_01743
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659	MGYG000000095_4|CGC6	76451.85	7.1159

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000095	5524222	Isolate	United Kingdom	Europe

• Gene Location: Start: 304212; End: 306191 Strand: +

Full Sequence      

MKKVQPAEELLEYYKSLYESEQKKVEDLESQLEESEKEIEELKFHLDRIKGSFVWRLSKP
FRGALHVYERTRDRLRRYGNVRGILRKIRSKMREKKAASRIHGTKSFPGPEEVQRQRKEK
FPKDVKISILVPLYNTPENFLREMIDSVLWQTYQNWELCLADGSDDAHEYVGEICREYQK
DTRIKYKKITENLGISGNTNVCLELATGNFIGLFDHDDILHPSVLYEVVKVICDKNADYV
YTDEATFEGKNINNMIVLHFKPDYSIDTLRANNYICHFSVFDVKLLDKTGLFRSAYDGSQ
DHDLILRLTTAAKNVQHIPKILYYWRSHKNSVASDINAKTYAIDAAKRAVQDHLKQCGLE
AKIESTRAFPTIFRLKYKLTAEPLISILIPNKDHKEDLSRCIDSIINKSTYQNFEIIVIE
NNSAEPEIFDYYEVIKKHPQIRVVTYEGSFNYSAINNFGVTFAKGEYLLFLNNDVKVITR
EWIEELLMYAQRPDVGAVGCKLYYSDNTIQHAGIVIGLGAHRAAGHTHYKEPKQNLGYMG
RLCYAQNVTAVTGACLFVSRSIYDEVGGLDESFAVALNDVDFCLKIRKKGYLNVFTPFAE
LYHYESKSRGLEDDKAKAERYNEETARFRDKWKQELEAGDPYYNKNFSLDYSDYSLKLE

Enzyme Prediction     

No EC number prediction in MGYG000000095_01743.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	128	288	1.4e-23	0.9823529411764705
GT2	386	566	5e-21	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.82e-84	126	326	2	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.25e-44	387	605	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.88e-32	382	610	2	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.97e-21	128	286	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	1.07e-18	128	331	1	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO22278.1	0.0	47	658	19	630
QNM02106.1	8.23e-274	14	657	6	678
ADL33299.1	4.25e-273	14	659	6	674
AOZ95572.1	9.91e-270	14	659	6	676
CAB1243278.1	4.58e-262	49	657	413	1033

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	8.61e-12	127	333	7	223	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	3.62e-128	127	656	368	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.26e-85	127	657	321	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q1RIM7	1.09e-17	127	474	15	379	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
Q4UM29	2.46e-15	127	595	16	498	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
A0A0H2URH7	1.06e-13	124	247	4	124	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000095_01743.