CAZyme Information: MGYG000000095_02554

Basic Information

• Species: GCA-900066755 sp902363085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp902363085
• CAZyme ID: MGYG000000095_02554
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
825	MGYG000000095_7|CGC4	93990.36	4.8031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000095	5524222	Isolate	United Kingdom	Europe

• Gene Location: Start: 196343; End: 198820 Strand: -

Full Sequence      

MEEKERLYPLTDLYADNTQKTYGREAESCAFLLGGIGTGNISVGARGELKSWQIFNQPAV
ENINPYTFFAIRTQEEDGTITAKVLESEYTPPFAKPQGFLRCETAGWPRLSDSRLSSRYP
FVQVEFQDKDLPVQVSLEAYTPFIPLNADDSGIPGACLRYRVKNPTNRPVTVSVAGSLNN
AVGFTGYDMFDIMTFQGERRNEKRESGRLKGVFMRGDKLPDNLLSNGTMALAVTDEKATV
RPYWLLGQWTDGAEDFWEDFTSDGELDESSSVEARGCRMAELFDYTYLHFFFRVGAVCSK
RVVKPGGEELFEFMITWSFPNRVKGWPDSIGALEAVKNGEYETIRNYYAARFPDAWSAAE
YLDQQKERLEAGSRMFSNAFYQTTLPGYVLEAAADNITVLRSPTCFRIENGDFLGWEGVD
RTAGCGSGTCTHVWNYAQTVAFLFPELERSMRRIEFLKETRENGHMAYRTYRGLGLEQWD
MLPSADGQLGTVVRFYREWKLSGDDEFLRESWEKIVSCMEFAENTWDQDQDGVLEQAQHV
TYDTELYGITSMVSTIYLAALKASAEMAGYLKDEKRAEKFRDRFEAGSKKLDEISFNGEY
YIQILDRLENYRYQYGEGCLSDQLLGQFMAHCAGLGYVLPKEHVKKASESIFKYNFIRHA
RDYVHGERAFILNDESGLTPCTWPKGGKPRFPFTYYGEVWTGIEYEAATLLLYSGLIDEG
LTVVKAVRDRHDGYRRNPWSEVESGNYYTRSMASYGVLLALTGFAFDHRTGTISFKPQIN
GDDFSSFWCNGKAWGIYHQKKDAQTGELHKEMEVLYGQGDDIRVI

Enzyme Prediction     

No EC number prediction in MGYG000000095_02554.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	411	757	5.8e-68	0.9944903581267218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12215	Glyco_hydr_116N	7.41e-73	30	369	1	309	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
pfam04685	DUF608	4.44e-52	411	757	1	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG4354	COG4354	9.41e-49	33	764	17	720	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZN42723.1	6.46e-306	6	824	12	819
QHW30807.1	2.96e-295	8	824	7	811
QNM02725.1	4.47e-291	16	824	12	819
AUA17208.1	2.18e-277	9	817	4	811
ALS26632.1	4.19e-273	19	824	14	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FJS_A	1.33e-36	33	747	56	766	Bacterialbeta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5FJS_B Bacterial beta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5O0S_A Crystal structure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with unreacted beta Cyclophellitol Cyclosulfate probe ME711 [Thermoanaerobacterium xylanolyticum LX-11]
5NPF_A	1.39e-36	33	747	59	769	Crystalstructure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with beta Cyclophellitol Cyclosulfate probe ME594 [Thermoanaerobacterium xylanolyticum]
5BVU_A	1.40e-36	33	747	60	770	Crystalstructure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],5BX2_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with 2-deoxy-2-fluoroglucoside [Thermoanaerobacterium xylanolyticum LX-11],5BX3_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with deoxynojirimycin [Thermoanaerobacterium xylanolyticum LX-11],5BX4_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with Glucoimidazole [Thermoanaerobacterium xylanolyticum LX-11],5BX5_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with glucose [Thermoanaerobacterium xylanolyticum LX-11],5NCX_A Crystal structure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase with an covalent inhibitor [Thermoanaerobacterium xylanolyticum LX-11],5OST_A Beta-glucosidase from Thermoanaerobacterium xylolyticum GH116 in complex with Gluco-1H-imidazole [Thermoanaerobacterium xylanolyticum LX-11]
7W2V_A	1.62e-36	33	747	103	813	ChainA, Glucosylceramidase [Thermoanaerobacterium xylanolyticum LX-11]
7W2W_A	1.62e-36	33	747	103	813	ChainA, Glucosylceramidase [Thermoanaerobacterium xylanolyticum LX-11],7W2X_A Chain A, Glucosylceramidase [Thermoanaerobacterium xylanolyticum LX-11]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9HCG7	2.55e-27	33	720	154	841	Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2
Q5M868	6.39e-25	33	720	145	832	Non-lysosomal glucosylceramidase OS=Rattus norvegicus OX=10116 GN=Gba2 PE=2 SV=2
Q69ZF3	1.02e-23	33	720	145	832	Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2
Q7KT91	1.31e-12	516	719	693	890	Non-lysosomal glucosylceramidase OS=Drosophila melanogaster OX=7227 GN=CG33090 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999937	0.000078	0.000006	0.000000	0.000000	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000095_02554.