CAZyme Information: MGYG000000095_04405

Basic Information

• Species: GCA-900066755 sp902363085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp902363085
• CAZyme ID: MGYG000000095_04405
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	MGYG000000095_19|CGC1	65203.4	5.298

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000095	5524222	Isolate	United Kingdom	Europe

• Gene Location: Start: 77218; End: 78966 Strand: +

Full Sequence      

MKMESNGGQSFFDFNDNNIRPAADVDVRKRIYLCPRKILWQTEEDGAQVENSGALLLDRS
VQISLEATNPCILRNNGKKAGVLLDFGVEIHGGIIISAWKENKGAGTKVRVRFGESAMEA
MSDIGDDKNATNDHANRDIITNISSMSMTPVGETGFRFVRLDLMEEQAELVLKTVKAVLI
IKDVPYRGSFQSSDELLNRIWYTGAYTVHLNMQDYIWDGIKRDRLVWVGDMHPEITTIQA
VFGSDQSITRSLEFVKAETPLPGWMNGYPAYSMWWILILHDYFLHTNDLEYLKSNREYLL
GLSDQLSASIDENGKDTTPQIRFLDWPSHADTVVVDAGLQALHTIAAQKLKRIFQILGEK
EHELRCGEDLMRLKKYPADYKESKQAAALLVMAGLLDANTANEKLLKAGGAKGMSTFMGY
YILTARAMAGDLTGCLDCVRDYWGGMLRLGATTFWEDFDVEWMEHAAPIDSLLHSPKEVD
IHGTFGRYCYKGYRHSLCHGWASGVTPWLTENVLGLKVLEPGCRLIGAEPKLGDLKWVKG
SFPTPCGEVCIQARQDEDGTIHASVSAPDEVEIRKMPGICWE

Enzyme Prediction     

No EC number prediction in MGYG000000095_04405.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	79	572	3.3e-92	0.9781746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.91e-11	188	474	4	326	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.005	515	572	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH21551.1	5.21e-218	26	573	10	555
QBM20341.1	1.54e-216	19	573	15	564
QGQ98689.1	2.79e-213	22	573	6	556
QMV41231.1	7.18e-206	26	573	8	555
QEC52590.1	9.04e-204	26	575	39	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	7.51e-36	59	549	170	672	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	6.64e-07	192	459	211	509	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000095_04405.