CAZyme Information: MGYG000000096_02158

Basic Information

• Species: Leuconostoc pseudomesenteroides
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Leuconostoc; Leuconostoc pseudomesenteroides
• CAZyme ID: MGYG000000096_02158
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000000096_10|CGC1	46449.09	8.8046

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000096	2296803	Isolate	Canada	North America

• Gene Location: Start: 5620; End: 6840 Strand: -

Full Sequence      

MIIVSNILQFYTTYYPIIMTLIWILGSWISGNQSHTSDSKYDSLLNASVTILLPTFNEEH
TVIDTLKSLVALNYTNYTIIVVDDKSNDCTVSVVKKWLLRNTPEVSIKLLELPSNMGKAQ
ALNEAMSYVESEYVLVTDADALMNPNALNQMLKKFDRENVGAVTGKPVVRNRTTILGRLQ
TLEYVGIIDRIKRAQDSLFGGIMTVAGVIALYRSEALSDVGGFDKTVVTEDIDMTWRLRR
KKWLIHYTPLALTYILVPETFSGYFKQRIRWSVGGLEVFLKNAKWVYHNEDVKQKFLLFD
MLFSHIWAWLALITFFQYIIVTIGTQTFSLPGVIILIYIALFSIMICQGIIQDKRHSQLS
FHDVFEIPFYSTFYWTTALITAIASQIIVCTLHRRKGSWTSPDRGR

Enzyme Prediction     

No EC number prediction in MGYG000000096_02158.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	49	274	9e-37	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11204	PRK11204	8.61e-102	1	405	3	417	N-glycosyltransferase; Provisional
PRK14583	hmsR	8.32e-76	1	405	23	438	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
COG1215	BcsA	9.40e-61	1	380	4	391	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	2.11e-53	51	231	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06439	CESA_like_1	9.32e-40	15	276	5	249	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEA42402.1	2.20e-294	1	406	2	407
QQB28409.1	1.70e-282	1	406	2	407
AHF19114.1	5.31e-183	1	406	1	403
QHM58163.1	5.31e-183	1	406	1	403
QAR69150.1	5.51e-183	1	406	2	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	2.40e-13	23	270	22	259	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	2.42e-13	23	270	23	260	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5TZE_C	1.13e-07	50	159	4	112	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	1.58e-07	50	159	4	112	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75905	2.47e-66	14	405	36	437	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q8XAR5	3.47e-66	14	405	36	437	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
Q5HKQ0	1.79e-65	14	405	9	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	3.53e-65	14	405	9	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HCN1	4.85e-61	14	405	9	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.909162	0.088618	0.000452	0.000129	0.000127	0.001531

TMHMM  Annotations     

start	end
10	32
243	265
301	323
330	352
367	389