CAZyme Information: MGYG000000096_02275

Basic Information

• Species: Leuconostoc pseudomesenteroides
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Leuconostoc; Leuconostoc pseudomesenteroides
• CAZyme ID: MGYG000000096_02275
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		43704.46	9.7326

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000096	2296803	Isolate	Canada	North America

• Gene Location: Start: 2132; End: 3253 Strand: -

Full Sequence      

MTKRILSFVWFFIVILLFVFSVQYVKNESSEHNKQEIYSQWQHKYIIKTPQGRYVNTSSR
SENGVVLSEAQGYGMLISVLNNQDKASESQFYDLYTYYKHHRVKGTYLMSWRYTNGAKQQ
KQADLKNNATDGDLYIAYALILASEKWSQHRSVYESTAKQILDDILKYNVNYNNNILTVG
NWADGSSKYQNLMRTSDVLPSFFDKFYKFSQNSQWLIIKNKMLDSLYQASRQSKVGLVPD
FIQVTNDNKVKSLTYGKNVKLNKHDDDYYYNAFRIPYNLALDKDRSSKENQILIKLMNFF
SSLEKISSGYNMSGKPLNKFQSTSISAPLFYAASTSQKWHTLYQKQSFILDYDRLNHNYY
DDTLLVLILYSTK

Enzyme Prediction     

No EC number prediction in MGYG000000096_02275.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	37	369	4.5e-70	0.98125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	3.08e-25	38	276	8	227	Glycosyl hydrolases family 8.
COG3405	BcsZ	1.35e-15	11	284	7	256	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	1.51e-08	39	167	26	150	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEA42565.1	1.64e-263	1	373	1	373
QQB26585.1	2.72e-262	1	373	1	373
QEA59958.1	3.16e-217	1	371	1	371
BAL50591.1	9.04e-217	1	371	1	371
AII11790.1	9.04e-217	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	3.06e-26	24	364	52	394	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	1.40e-24	19	339	16	349	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	1.57e-24	19	339	22	355	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	3.09e-11	50	167	18	125	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
5GY3_A	2.40e-08	50	170	14	124	ChainA, Glucanase [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	8.93e-26	24	364	52	394	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	5.28e-21	24	338	77	401	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P18336	1.21e-07	50	170	37	147	Endoglucanase OS=Cellulomonas uda OX=1714 PE=1 SV=1
P37696	1.52e-07	50	276	41	250	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
P27032	3.48e-06	33	276	25	245	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.653214	0.342141	0.002770	0.000396	0.000290	0.001195

TMHMM  Annotations     

start	end
5	24