CAZyme Information: MGYG000000097_00899

Basic Information

• Species: Ligilactobacillus animalis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus animalis
• CAZyme ID: MGYG000000097_00899
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase Mel36A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
732		83239.64	5.2808

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000097	1849821	Isolate	Canada	North America

• Gene Location: Start: 41739; End: 43937 Strand: +

Full Sequence      

MNKLIEFDEKNKVFHLHNDKISYILSVEEGGYLSHLYFGKKVNGYHGQLRYPRVDRGFSG
NLPESLDRTYSLDSLLQEYSGVGNCDYRTPALDLQNADGSFAARLVYQGYEITAGKPKLE
GLPAAYANADEAQTLVLFLKDEVSGVEVTLLYTIFKDLAIVARSAKVTNAGAEPVELKKV
ASMQLDFIKQDMDVISLPGAHANERHIQREAIGQGRKVFESRRGASSHQMNSFIAVLEHN
ADEFSGEVYGFNLVYSGNHSFEIEKDQFEQTRVVAGINDYNFSWHLEAGESFQAPEVLLA
FSANGLNEMSQNYHELIREHIVRGKFKHQEREILVNNWEATYFEFNEDKLKTIVDDAKEL
GIEMFVLDDGWFGHRDDDNTSLGDWTVYERKFPQGIKHFADYVHEQGLKFGLWFEPEMIS
IDSKLYQEHPEYLMQVPGRKPSPSRNQFILDLTQKAVRENVVAQLSALLDGGFIDYIKWD
MNRHISDVYSVSLPKQRQGEVYHRYMLGLYEILETLTTKYPDILWEGCSGGGGRFDTGYA
YYMPQSWTSDNTDAIARQTIQYGTSLVYPPSVFTAHVSAVPNHQTGRITPFETRGAVAMS
AVFGYELDLTQLTADEKEAVKEQVKTYKAIRPLVQFGDFIRLKDPAKGNQCAWMFVSRDK
NEALVFVFDRLASAQPTLTLTKLAGLDPAKNYQDQKTKALFSGNELMELGFYDPVKRHDF
TADMYHFKAVTD

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	13	711	1.3e-285	0.9956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02065	Melibiase	0.0	291	637	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	0.0	11	719	1	673	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14791	GH36	5.48e-142	330	629	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	1.25e-126	31	287	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	9.52e-24	650	727	1	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ69710.1	0.0	1	732	1	732
QCQ03635.1	0.0	1	732	1	732
AWZ38451.1	0.0	1	732	1	732
AWZ40554.1	0.0	1	732	1	732
QIA89855.1	0.0	1	732	1	732

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	0.0	4	730	5	731	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	0.0	4	730	5	731	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
4FNR_A	5.50e-266	5	730	3	727	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNQ_A	5.50e-266	5	730	3	727	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNU_A	5.12e-264	5	730	3	727	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1UB44	0.0	4	730	5	731	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	0.0	4	732	3	732	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
Q9ALJ4	3.01e-265	5	730	3	727	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G4T4R7	2.05e-230	5	732	3	722	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
P27756	2.81e-189	10	727	6	717	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000097_00899.