CAZyme Information: MGYG000000097_01413

Basic Information

• Species: Ligilactobacillus animalis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus animalis
• CAZyme ID: MGYG000000097_01413
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
171	MGYG000000097_7|CGC2	18761.13	9.872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000097	1849821	Isolate	Canada	North America

• Gene Location: Start: 24561; End: 25076 Strand: -

Full Sequence      

MTRKHHHDKRSRRGLALVLKIGAAVLVVLLVCVIAWKNETVHSRLVSAFGDNEKLQKAEY
DKQRALAAKKYGSSTKEEAKVVDKESVKADPSQSSTVKKASESERSSSNSNYGTYTVQSG
DYLSTIAAKYNTTVQELIELNDLESSRVAAGVTLKVPMQEQQTSTRSAATE

Enzyme Prediction     

No EC number prediction in MGYG000000097_01413.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01476	LysM	4.69e-13	115	157	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	2.34e-12	114	156	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.28e-09	114	156	1	44	Lysin motif.
PRK10783	mltD	1.79e-08	113	156	344	387	membrane-bound lytic murein transglycosylase D; Provisional
COG1388	LysM	9.74e-07	72	157	26	111	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ69596.1	3.69e-107	1	171	1	171
AWZ40421.1	2.02e-74	1	171	1	170
QIA89727.1	2.02e-74	1	171	1	170
AWZ38583.1	2.02e-74	1	171	1	170
QCQ03518.1	1.37e-73	1	171	1	175

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	3.84e-07	114	160	4	50	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	4.02e-06	114	160	4	50	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995245	0.000231	0.000283	0.000002	0.000001	0.004274

TMHMM  Annotations     

start	end
13	35