CAZyme Information: MGYG000000098_00392

Basic Information

• Species: Bacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000098_00392
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42399.67	4.4462

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000098	4868436	Isolate	Canada	North America

• Gene Location: Start: 79992; End: 81113 Strand: +

Full Sequence      

MIKRKILLLLSMALMGISSIACSDDETNDITPQKRYPLTSFSVAVKGTQADNISYYHGKI
DQTTHRVEIGYIEDANMITGVDYTLMSEGATISPDPKKFIGEWNKEQKVTVTTEDNQTTT
YTIVLTKFDEAMKNILFFDNFSVDGNPDPTKWVLCKKQGSDWNDEMSESYDQAYVEDGKL
ILKAEKINGEYKAGGIESQGKFDFTFGKIEVKARITSYPNGAFPAIWMMPKTPVYGGWPQ
SGEIDIMEHIKQESVIHHTIHTHYTYDLGIKDPTNTAQITCDYQDWNIYTVEKDENKLTF
FVNGQETFSYSNLNLENEAEMKQWPFTNENPFYIILNMGLGGDRDGSWPGPIDDDNLPAI
MEIDYVKVSKLDK

Enzyme Prediction     

No EC number prediction in MGYG000000098_00392.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	139	368	1.2e-55	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	1.53e-78	137	368	1	234	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
pfam16341	DUF4971	4.00e-63	2	141	1	139	Domain of unknown function (DUF4971). This small family consists of uncharacterized proteins around 370 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.
cd02182	GH16_Strep_laminarinase_like	7.07e-30	134	368	3	257	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd08024	GH16_CCF	4.77e-29	192	368	100	328	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd00413	Glyco_hydrolase_16	1.16e-25	139	368	1	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA52161.1	9.47e-231	1	373	1	373
ALJ39846.1	3.71e-230	3	373	2	372
QMW89124.1	5.27e-230	3	373	2	372
AAO77930.1	5.27e-230	3	373	2	372
QUT40804.1	5.27e-230	3	373	2	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2O_AAA	3.40e-45	130	372	32	276	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2O_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]
6T2P_AAA	9.40e-45	130	372	32	276	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2P_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_AAA Chain AAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]
6T2S_AAA	1.81e-43	134	371	1	240	ChainAAA, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565],6T2S_BBB Chain BBB, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565],6T2S_CCC Chain CCC, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565]
6T2R_AAA	1.48e-40	135	367	31	259	ChainAAA, Beta-glycosidase [Bacteroides caccae]
3ILN_A	6.63e-37	135	368	7	246	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	8.65e-45	135	371	58	289	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	1.68e-35	135	368	42	281	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	1.70e-24	146	370	450	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q27082	3.33e-18	162	368	52	251	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
C1IE32	7.90e-14	173	367	62	265	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000319	0.078082	0.921358	0.000095	0.000097	0.000072

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000098_00392.