CAZyme Information: MGYG000000098_00649

Basic Information

• Species: Bacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000098_00649
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705	MGYG000000098_3|CGC1	80721.91	7.2403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000098	4868436	Isolate	Canada	North America

• Gene Location: Start: 139381; End: 141498 Strand: +

Full Sequence      

MSKFPATSFRYLVISLLLLICFHPLIQGANKKIKNNNWEISYQPSTRTIDYSYKGQNILK
GTFVKAKVNTTEIRSCDFKTTEIQKEKINDGVGKGKKYTITYSDGPLSNIKIEQNYYFYP
DKEYFLTEVWLCSANEKITSNYIAPVYTSEKNSFLPQDSTNRVLRVPYDNDAFVSYLSAP
LKEEGISFEVTAIFNGISRNGLVIGSVEHDTWKTGIRYQGENDRYITHLECFGGVTHELT
RDISDRSDRPSKEHGSVRGTRLKSPQIFVGYFNDWRKGMEKFGEMNATITPPRQWNSGTP
FGWNSWAAMATKVNYEGAVDIADFIKQELQPNSFENDNTVYIGLDSFWDNFNEEQLIAFA
RHCKENGQKAGIYWCPFSDWFGNADGFVEGTDQQWKYKDIYLYANGKPRKIESLAVDPTH
PGTKLRMKHYIEKFKKWGYTYIKLDFINNGSLEADSFYNPNVTTGTQAYNEGMKYLSELC
GNDMFMALSIAPVFPAQYGNSRRISCDTWGAMSEQGWGTTNYMLNSLSFGWWLDRVYTFN
DADHILLHKPEEAENYKEGANRARITSAVITGIYMLGDNFSTKGSIPGSEEARRKAASLV
TNKEINKIARLGKSFYPVEGYTAQSPEKAESMYMMETDDYTYIVIFNFDITSVKEGCLDM
RRIGYSPNKHIEGKELWTSTPVISDHKGLQYSVPPQDVRVYRIKK

Enzyme Prediction     

No EC number prediction in MGYG000000098_00649.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	6.40e-12	300	579	3	278	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	1.41e-09	300	543	2	214	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EIY66649.1	3.11e-215	9	705	56	748
QUT74114.1	7.09e-214	9	705	56	748
BCI61924.1	1.67e-205	12	703	7	688
QQA08702.1	4.00e-188	16	704	17	673
ALJ44661.1	1.60e-187	16	704	17	673

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000556	0.998433	0.000503	0.000172	0.000164	0.000151

TMHMM  Annotations     

start	end
7	26