CAZyme Information: MGYG000000098_01157

Basic Information

• Species: Bacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000098_01157
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287	MGYG000000098_6|CGC2	32963.68	7.0697

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000098	4868436	Isolate	Canada	North America

• Gene Location: Start: 99588; End: 100451 Strand: -

Full Sequence      

MKKILLFALAFISIATTVYAQGSRVYETHTVKSKILGMERHYSIYLPAGYNENDCSYPVL
YLLHGHGDNHTGWIQFGQVQRIADKAIAEGKATPMIIVMPDADSVHKGYFNLPDGSYNYE
DFFFKELIPHIEKTYRVRAEKRYRAVAGLSMGGGGTLFYALHYPEMFAAAAPLSAVSGKW
IIEQMRSMSDMSKVPAEKAESYFKQFSIEDILKSSEDKVNAIKWVRWYISCGDDDFLTID
NSLLHIQLRQNQIGHEYRVKDGGHSWSYWRMELPEVMEFVSRSFIQY

Enzyme Prediction     

No EC number prediction in MGYG000000098_01157.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	281	3.2e-62	0.9823788546255506

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.79e-39	33	275	75	290	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.89e-35	33	275	1	241	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	5.81e-32	39	286	34	314	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG4099	COG4099	3.81e-12	26	180	160	304	Predicted peptidase [General function prediction only].
COG3509	LpqC	1.02e-10	4	175	12	177	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA07664.1	1.32e-39	33	273	158	393
CEA15670.1	4.25e-39	33	282	145	376
AHW58565.1	1.20e-35	33	273	157	380
QEC71632.1	1.68e-35	33	273	410	634
SCD19884.1	3.44e-35	38	283	155	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	4.77e-57	28	284	14	272	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	3.06e-36	32	275	138	379	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	2.02e-29	44	283	50	260	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	5.51e-29	44	283	50	260	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	3.83e-25	44	280	157	384	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	6.18e-27	44	283	69	279	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	9.61e-20	40	275	445	663	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	1.49e-18	30	186	504	663	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	9.79e-17	30	284	147	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P9WM38	2.41e-16	32	171	180	315	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000245	0.999126	0.000158	0.000154	0.000146	0.000139

TMHMM  Annotations     

start	end
4	26
145	163