CAZyme Information: MGYG000000098_01291

Basic Information

• Species: Bacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000098_01291
• CAZy Family: GT10
• CAZyme Description: Alpha-(1,3)-fucosyltransferase FucT

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	MGYG000000098_7|CGC2	37746.01	5.1764

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000098	4868436	Isolate	Canada	North America

• Gene Location: Start: 92368; End: 93318 Strand: +

Full Sequence      

MKLKINFADFWPTFDRHCNFFIELLSKKYEVEVCEDPDYLIYSIFGYENLQYDSCVKIFY
VGENITPDFNLCDYAIGFDLMEFGDRYMRLPYYVLYDIEKLATPKIIDAEAVLNRKFCSF
VVSNANASPERNRFFHLLSEYKKVDSGGRFENNVGGPVENKREFISQYKFNIAFENSMRD
GYTTEKIMEPMLVNSLPIFWGNRKVGLDFNPSSFIDASDYPSLEALVEHIVQLDTNDEEY
LSILSEPWLNQDNYLDWKERLVAFFDRIIDKPREEQKYLSPYGYGNNYRMRLRRMLRAYK
SKEKLKNIYKPKYWFK

Enzyme Prediction     

No EC number prediction in MGYG000000098_01291.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	98	245	2.9e-47	0.4322766570605187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18025	FucT_N	1.73e-45	5	96	1	92	Alpha-(1,3)-fucosyltransferase FucT N-terminal domain. This is the N-terminal domain of the alpha chain found in Helicobacter pylori Fucosyltransferase protein which is involved in the production of Lewis x trisaccharide, a major component of lipopolysaccharide. The N-terminal domain contains the catalyst base, Glu-95 which is equivalent to the Asp-100 of other members of the glycosyltransferases-B family. The domain contains the pocket where LacNAc binds. The domain is composed of 2-10 heptad repeats and a conserved N-terminal alpha-beta-alpha motif which has little sequence similarity to the conserved N-terminal motif in other glycosyltransferases.
pfam00852	Glyco_transf_10	9.59e-26	121	261	8	140	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63450.1	2.70e-157	3	316	4	314
QCQ56021.1	8.35e-120	2	289	3	291
QCT79965.1	2.09e-117	2	289	3	290
CAH09151.1	3.14e-117	2	289	15	302
QCQ38686.1	3.14e-117	2	289	15	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	9.49e-54	3	270	26	340	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	5.93e-53	3	270	26	340	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30511	5.65e-52	3	270	26	340	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
Q5UQ63	4.13e-24	116	256	425	576	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
Q70AG8	6.64e-14	120	244	221	358	Alpha-(1,3)-fucosyltransferase 11 OS=Takifugu rubripes OX=31033 GN=fut11 PE=2 SV=1
Q8AWB5	8.52e-14	120	281	213	405	Alpha-(1,3)-fucosyltransferase 10 OS=Gallus gallus OX=9031 GN=FUT10 PE=2 SV=2
Q11126	1.06e-13	116	278	195	354	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 OS=Bos taurus OX=9913 GN=FUT3 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000098_01291.