CAZyme Information: MGYG000000098_01294

Basic Information

• Species: Bacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000098_01294
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
633	MGYG000000098_7|CGC2	73009.63	9.1371

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000098	4868436	Isolate	Canada	North America

• Gene Location: Start: 96105; End: 98006 Strand: +

Full Sequence      

MKNILKYITSLVQNPIILCILWFGMAMRGCWKSWLEGFSNNYIIFSQSFYHALEQTPLYI
EYPKEYFDLFLYGIPFTLLIAPFSILPPMVGSALWCFFNAYLLYIAVKKLGFEKWKFALI
IWLSYNGLYLSLLFQQYNVAITAFIIFSFILIEKKKDFWAALVIVLGTLTKIYGIVGLAF
FLFSKRRLQLLSGLLFWGMILFVVPMIYTSPNYVIDSYGEWLNVLIMKNDLNQSSIYQNI
SLLGMVRRFTHATEFSDWWITVPALILFVLPYFRINQYNSRSFRLSFLASALLFMILFST
GTEESGYVAALVAVGIWYVSTPTRNKTFVLNLCLLLFCLILTALSSNGMFFSRRVRGEYI
IAFALKALPCTIIWLKIIWEQLTQNYVTDCPKPISQSDKESRIDVILPCYNPHEGWEKQL
IEKHTELEGMLNGRDIRFIVVNDGSKHGFTENAVQSLRTALPNTVIVDNKINQGKGGAVR
DGIAHSDSKLALYTDYDFPYQIDSVCQVIHHLEEGYDVVVANRNHTYYSQLSKRRKLASY
SSRFLNFMLLGLTHTDTQGGLKGFNQKGKAFLASTRTKQFLFDTEFIYKASLDDTTFIKE
VPVDLRSEVMLPNMKKGVFMNELKNLFLICWRG

Enzyme Prediction     

No EC number prediction in MGYG000000098_01294.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	404	548	2.6e-17	0.8294117647058824

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09594	GT87	2.01e-34	70	296	1	235	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.
cd04188	DPG_synthase	4.77e-27	405	604	1	203	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
cd04179	DPM_DPG-synthase_like	1.66e-25	405	590	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
PTZ00260	PTZ00260	4.64e-13	380	604	47	287	dolichyl-phosphate beta-glucosyltransferase; Provisional
pfam00535	Glycos_transf_2	8.91e-13	404	567	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73486.1	0.0	1	633	1	633
QQA08480.1	0.0	1	633	1	633
BCA52700.1	0.0	1	633	1	633
ALJ44426.1	0.0	1	633	1	633
QMW85777.1	0.0	1	633	1	633

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q45539	4.47e-06	399	546	2	144	Putative glycosyltransferase CsbB OS=Bacillus subtilis (strain 168) OX=224308 GN=csbB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999991	0.000022	0.000001	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
7	26
85	107
128	150
161	183
190	209
258	275
282	299
304	321
328	350